KEGG   Loxodonta africana (African savanna elephant): 100657751
Entry
100657751         CDS       T04351                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X4
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04071  Sphingolipid signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04622  RIG-I-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav04920  Adipocytokine signaling pathway
lav05132  Salmonella infection
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657751 (TRADD)
   04064 NF-kappa B signaling pathway
    100657751 (TRADD)
   04668 TNF signaling pathway
    100657751 (TRADD)
   04071 Sphingolipid signaling pathway
    100657751 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100657751 (TRADD)
   04217 Necroptosis
    100657751 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100657751 (TRADD)
   04657 IL-17 signaling pathway
    100657751 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100657751 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100657751 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657751 (TRADD)
   05152 Tuberculosis
    100657751 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100657751 (TRADD)
   05160 Hepatitis C
    100657751 (TRADD)
   05164 Influenza A
    100657751 (TRADD)
   05162 Measles
    100657751 (TRADD)
   05168 Herpes simplex virus 1 infection
    100657751 (TRADD)
   05163 Human cytomegalovirus infection
    100657751 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657751 (TRADD)
   05169 Epstein-Barr virus infection
    100657751 (TRADD)
   05165 Human papillomavirus infection
    100657751 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death
Other DBs
NCBI-GeneID: 100657751
NCBI-ProteinID: XP_003417161
UniProt: G3SXW8
LinkDB
Position
Unknown
AA seq 310 aa
MAAGPNECEEWVGSAYLFVESAVDKVILSDAYAHPQKKVAVYSALRTSLAESGGSPDQLQ
MLKIHRSDPQLILQLRFCGRQPCDRFLRAYREGALRAALQRCLAAALALNSVRLHLELRA
GAERLDTLLPDEERCLNCIFAQKPDRLRDEELSELEDALRNLTCGSGDQGDNEEATPAPL
QSQTPSPSEEKPPPRSGQTFLFQGQPIVNRPLNLQDQQTFARSVGLKWRKVGRSLQRGCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLL
GLADPDGRLV
NT seq 933 nt   +upstreamnt  +downstreamnt
atggccgcggggccaaatgaatgcgaggagtgggtgggcagtgcatacctgtttgtggag
tctgcggtggacaaggtgatcctgtcagatgcctacgctcacccccagaagaaggtggcg
gtgtacagcgccctgcggacctcattggcagagagcggcgggagcccggaccaactacaa
atgcttaagatccaccgcagcgacccgcagctgatcttgcagctgcgtttctgcggacgt
cagccgtgcgaccgctttctccgcgcctaccgcgagggggcgttgcgcgccgcgctgcag
aggtgcttggcggcggcgcttgccctgaactccgtgcgattgcatctggagctgcgcgct
ggcgctgagcggctggacactttactgcctgacgaggagcggtgcttgaactgcatcttt
gcccagaagcccgaccggctgcgggacgaagagctgtctgaactggaggatgcgctccgg
aatctgacgtgcggctccggggatcagggtgacaacgaggaggcgactccggcccccttg
cagtcccagacaccctccccgtcggaggagaagccaccgccgcgatctggccagactttt
ctgttccagggtcagcccatagtgaaccggccgctgaacctacaggaccagcagacgttc
gctcgctcagtggggctcaaatggcgcaaggtggggcgctcgctgcagcggggctgccga
gcgctgcgggacccggccctggattctctggcctatgagtacgagcgtgacgggctgtac
gagcaggccttccagctactgcggcgcttcgtccaggccgagggccgccgcgccacgctg
caacgcctggtggaggcgctggaggagaacgagctcaccagcctggcggaggacttgctg
ggcctggcggatcccgatggccgcctagtttag

DBGET integrated database retrieval system