KEGG   Loxodonta africana (African savanna elephant): 100657804
Entry
100657804         CDS       T04351                                 

Gene name
SLC17A7
Definition
(RefSeq) vesicular glutamate transporter 1
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100657804 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    100657804 (SLC17A7)
   04721 Synaptic vesicle cycle
    100657804 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100657804 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100657804 (SLC17A7)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   100657804 (SLC17A7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    100657804 (SLC17A7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 100657804
NCBI-ProteinID: XP_023399011
LinkDB
Position
Unknown
AA seq 493 aa
MSGLGFCISFGIRCNLGVAIVSMVNNSTTHHRGHVVVQKAQFSWDPETVGLIHGSFFWGY
IVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTY
PACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIF
WYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAI
IVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRS
RRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHL
DIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYG
VFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHST
VQPPRPPPPVRDY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagtgggctgggcttctgcatcagctttggcatccgctgcaacctgggcgtggctatt
gtctccatggtcaacaacagcacgacccaccaccggggccacgtggtggtgcagaaagcc
cagttcagctgggatccagagactgtcggcctcatacacggctcctttttctggggctac
attgtcacccagattcctggaggatttatctgtcaaaaattcgcagccaacagggttttc
ggctttgctatcgtggctacttccactctaaacatgctgatcccctccgctgcacgcgtc
cactacggctgcgtcatcttcgtgaggatcctgcaggggttggtagagggtgtcacctac
ccggcctgccacggaatctggagcaaatgggccccacccttagagcggagtcgcctggcc
actacggccttctgcggttcatatgctggggcggtggtcgcaatgcccctcgccggtgtc
ctggtgcagtactcgggatggagttccgtgttttatgtctacggcagcttcgggatcttc
tggtaccttttctggctactggtctcctacgagtccccggcgctgcaccccagcatctcg
gaggaggaacgcaaatacatcgaggacgccatcggcgagagcgccaaactcatgaacccc
gttacgaagtttaacactccctggcggcgctttttcacgtccatgccagtctacgccatc
atagtggccaatttctgccgtagttggacattctacctgctcctaatttcccagcctgct
tacttcgaagaggtgttcggcttcgagatcagcaaggtgggcctggtgtctgcgctgccc
caccttgtcatgaccatcatcgtgcccatcggcggccagatcgcagacttcctgcggagc
cgccggatcatgtccaccaccaacgtgcgcaagttgatgaactgcgggggcttcggcatg
gaagctacgctgttgctggtggtcggctattcacactccaagggcgtggccatctccttc
ctggtccttgctgtgggcttcagcggcttcgccatctcgggattcaatgtgaaccacctg
gacatcgccccacgctacgccagcatcctcatgggcatctccaacggcgtgggcacgttg
tcgggcatggtgtgccccatcatcgtgggtgccatgacaaagcacaagactcgggaagag
tggcagtatgtgttcctaatcgcctccctggtgcattatggaggtgtcatcttctacggg
gtctttgcttctggagagaagcagccgtgggcagagcctgaggagatgagtgaagagaag
tgtggcttcgttggccacgaccagctggctggcagcgatgacagtgaaatggaggatgag
gctgaacccccaggggcgccccctgctccacctccttcctacggggccacacacagcaca
gttcagcccccgaggcccccgccccctgtccgggactactga

KEGG   Loxodonta africana (African savanna elephant): 100662164
Entry
100662164         CDS       T04351                                 

Gene name
SLC17A8
Definition
(RefSeq) vesicular glutamate transporter 3
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100662164 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    100662164 (SLC17A8)
   04721 Synaptic vesicle cycle
    100662164 (SLC17A8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100662164 (SLC17A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100662164 (SLC17A8)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   100662164 (SLC17A8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    100662164 (SLC17A8)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 100662164
NCBI-ProteinID: XP_003405672
LinkDB
Position
Unknown
AA seq 589 aa
MPFKALDALKEKFVKPGKEGVKKAMGNSLGILQRKIDGTNEEEDNIELNEEGRPVQTSRP
SPPLFDCHCCGIPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEERTYIETTIGEGANIVSL
SKFNTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIIVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEW
QNVFVIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEETELNQERFA
SPRKKMSYGAMTQNCEVRKNEWRGHRGETLIEEELTSYQNEEGNFSDAS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccttttaaagctcttgatgccttgaaagaaaaatttgtgaaacctggaaaggaagga
gtgaagaaagccatgggaaattcgttggggattttgcaaagaaaaattgatggaaccaat
gaggaagaagataatattgagctgaatgaagaaggaaggccagtgcagacttccaggccg
agccccccactgtttgactgccactgttgtggcatccccaagcgttacatcatcgccatc
atgagcgggctgggattctgcatttcctttgggattcggtgcaatcttggagttgccatc
gtggaaatggtcaacaacagcactgtgtatgttgatggaaaaccagaaattcagacagca
cagtttaactgggatccagagacggtgggccttatccacggatcttttttctggggttat
attgtgacacagattccaggtggtttcatttcaaacaagtttgctgccaacagggtcttt
ggagcagccattttcctaacgtcgactttaaacatgttcattccttctgcggccagagtg
cattacggctgtgtgatgtgtgtcagaattttacaaggtctagtggagggtgtgacctac
ccagcctgccatgggatgtggagcaagtgggcaccacctttggagagaagcagactggcc
acaacctctttttgtggttcctatgcaggggcagtggttgccatgcccctggctggggtt
ttggtgcagtacattggatggtcctctgtcttttatatttatggtatgtttgggattatt
tggtacatgttttggctgttgcaggcctatgagtgcccggcagctcatccaacaatatcc
aacgaggagaggacctatatagagacaactataggagaaggagccaatatagtcagtcta
agtaaatttaatacaccatggaaaaggtttttcacatcactgccggtttatgcaatcatt
gtggcaaatttctgcagaagctggaccttttatttgctgttaataagccagcctgcttat
tttgaagaggtctttggatttgcaataagtaaggtgggtctcttgtcggcagtcccacac
atggttatgacaattattgtgcctattggaggacaactggctgattatttgagaagcaga
aaaattttgaccacaactgctgtgagaaaaatcatgaactgtggaggttttggcatggag
gcaaccttacttctggtggttggcttctcccataccaaaggggtggctatctcctttctg
gtgcttgccgtgggatttagtggctttgctatttcaggtttcaatgtcaatcacctggac
attgctccccgttatgccagcattctcatggggatctcaaatggagtaggaaccctctct
ggaatggtctgtcccctcattgttggtgcaatgaccaagcacaagacccgagaggaatgg
cagaatgtgttcgtcatagctgccctggtacactacagtggcgtgatcttttatggggtc
tttgcctctggggagaaacaggagtgggctgaccctgagaatctctctgaggagaagtgt
ggaatcattgaccaagatgaattagctgaggagacagaactcaaccaggagaggtttgca
agtccgcgaaagaagatgtcttatggggccatgacccagaattgtgaagtccgaaagaat
gaatggagagggcacagaggagagactcttattgaggaagagctgacgtcttaccagaac
gaagaaggaaatttctcagatgcatcctaa

KEGG   Loxodonta africana (African savanna elephant): 100669857
Entry
100669857         CDS       T04351                                 

Gene name
SLC17A6
Definition
(RefSeq) vesicular glutamate transporter 2
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100669857 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    100669857 (SLC17A6)
   04721 Synaptic vesicle cycle
    100669857 (SLC17A6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100669857 (SLC17A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100669857 (SLC17A6)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   100669857 (SLC17A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    100669857 (SLC17A6)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 100669857
NCBI-ProteinID: XP_003412364
LinkDB
Position
Unknown
AA seq 582 aa
MESVKQRILTPGKEGLKNFAGKSLGQIYRVLEKKQDTGEAIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMIWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
SKSYGATTQANGGWPNGWEKKEEFVQGEVQDSYTYKDPNDYS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagtcggtaaaacaaaggattttgaccccaggaaaagaggggctaaagaattttgct
gggaaatccctcggccagatctacagggtgctggaaaagaagcaagacaccggggaggcc
atcgagctgacggaggatgggaagcccctggaggtgcccgagaagaaggcgccgctgtgc
gactgcacctgcttcggcctgccgcgccgctacatcattgccatcatgagcggcctgggc
ttctgcatttccttcggcatccgctgcaatctgggcgtggccatcgtggacatggtcaac
aacagcaccatccatcgcgggggcaaggtcatcaaggagaaagccaaattcaactgggac
ccagaaaccgtgggaatgatccatggttccttcttttggggctacatcatcacccagatt
ccaggcggctacattgcttctcggctggcagccaacagggtctttggagctgccatactt
cttacctctaccctgaatatgctaatcccatcggcagccagagtgcattatgggtgtgtc
atctttgttagaatcttacaaggacttgttgagggtgtcacctacccagcatgccatggc
atatggagcaagtgggcccctcctctagagagaagtagattggcaaccacgtccttttgt
ggttcctacgctggagctgtgattgccatgcctttagctggcattcttgtacagtatact
ggctggtcttcagtattttatgtctatggaagctttggaatgatctggtacatgttttgg
cttttggtgtcttatgagagtcctgcaaagcaccctactattacagatgaagaacgtagg
tacatagaagaaagcattggagagagtgcaaatcttttaggtgcaatggaaaaattcaag
actccgtggaggaaattttttacatctatgcctgtctatgcaatcattgtggcaaacttc
tgcagaagctggactttttatttactgcttattagtcagccagcgtattttgaggaagtc
tttggatttgaaatcagcaaggttggcatgctatctgctgtaccccacttagtaatgaca
attattgtgcctattggaggacaaattgcagattttcttagaagcaagcaaattctttca
actactaccgtgagaaagatcatgaattgtggtggttttggcatggaagcaacactgctt
ctggtcgttggctactctcacactagaggggtagctatctccttcttggtacttgcagtg
ggattcagtggatttgctatatccggtttcaatgttaaccacttagatattgctccaaga
tatgccagtatcttaatgggcatttcgaatggtgttggcacattgtcaggaatggtttgc
cccatcatcgttggtgcaatgacaaagaacaagtcacgtgaagagtggcagtatgtcttc
ctgatcgctgctctagtccactatggcggagttatattttatgcaatatttgcctcagga
gagaagcaaccctgggcggaccctgaggaaacaagtgaagaaaagtgtggatttatccat
gaagatgaactcgatgaagaaacaggggacattactcaaaattatataaattatggtacc
agtaagtcctatggtgccacaacacaggccaatggaggttggcccaatggatgggaaaag
aaagaggaatttgtacagggagaagtacaagactcatacacctataaggacccaaatgat
tattcataa

DBGET integrated database retrieval system