KEGG   Loxodonta africana (African savanna elephant): 100657886
Entry
100657886         CDS       T04351                                 

Definition
(RefSeq) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
  KO
K07438  calcidiol 1-monooxygenase (25-hydroxyvitamin D3 1alpha-hydroxylase) [EC:1.14.15.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00100  Steroid biosynthesis
lav01100  Metabolic pathways
lav04928  Parathyroid hormone synthesis, secretion and action
lav05152  Tuberculosis
Module
lav_M00103  Cholecalciferol biosynthesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100657886
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100657886
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100657886
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100657886
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.18  calcidiol 1-monooxygenase
     100657886
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP27 family
   100657886
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100657886
NCBI-ProteinID: XP_003405215
UniProt: G3T696
LinkDB
Position
Unknown
AA seq 523 aa
MLRRNALFRGLPEPAMTQTLKLTYRVCHRVRWAPELGASLGSRGVCSAPRSLGDIPGPST
PGFLAELFCKGGLSRLHELQLQGAARFGPVWLASFGTVRTVYLAAPALIEQLLRQEGPLP
ERCSFSPWTEHRRQRQRACGLLTAEGEEWQRLRSLLAPLLLRPQAAAGYAGTLDSVVRDL
VRRLRRQREQAAGPPALVRDVAGEFYKFGLESIAAVLLGSRLGCLEAEVPPDTETFIRAV
GSVFVSTLLTMAMPNWLHRLVPGPWGRLCRDWDQMFAFAQQHVERREAEVAMRTHGKPEG
DVAPGVHLTYFLFREKLSAPSILGNVTELLLAGVDTVSNTLSWALYELSRHPDIQMALHS
EITAALGPSSCAHLPATALSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKS
TLVTLCHYATSRDPAQFPEPNSFRPARWLGEGPAPHPFASLPFGFGKRSCMGKRLAELQL
QMALAQILTHFEVRPEPGAAPIRPMTRTVLVPERSINLQFVDR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgctccggagaaacgccctctttcgcgggcttcctgaaccagccatgacccagaccctt
aagcttacttacagggtgtgccatcgcgtccgctgggctcccgagctgggcgcctcactg
ggctccagaggcgtctgctcagcgccccggagcttgggggatatcccaggcccgtccacg
cccggctttctagccgaactcttctgcaaggggggactgtctcggctacacgagctgcag
ctgcagggcgccgcgcgcttcggtccggtgtggttggccagtttcgggaccgtacgcaca
gtgtacctggcggctcctgcgctcattgagcagctgctgcgacaggaggggcccctgcca
gagcgctgcagcttctcgccctggaccgagcaccggcgccagcggcagcgggcttgtgga
ctgctcaccgcggaaggtgaggagtggcagaggctccgcagcctcctggccccgctcctc
cttcggcctcaagcagccgcgggatacgccggaaccctggacagcgtggtccgtgacctt
gtgcggcgattgcggcgccagcgggaacaggccgctgggccgcccgccctggttcgggac
gtggcgggagagttttacaagttcgggttagaaagcatcgccgcggtactgctgggttcg
aggctgggctgtctggaggccgaagtgccgccggacacagagacattcatccgcgcagtg
ggctctgtgtttgtgtccacgctgctaaccatggcgatgccgaactggctgcaccgtcta
gtgcctggaccttggggccgcctctgccgtgactgggaccagatgtttgcatttgcccag
cagcacgtggagcgacgagaggctgaagtggccatgaggacccatggaaagcctgagggg
gatgtggcacctggggtgcatctgacctacttcctgttccgagaaaaactgtctgccccg
tccatcctggggaatgtgacagaactgctgctggccggagtggacacggtgtccaacact
ctctcctgggctctgtatgagctctctcggcaccccgacatccagatggcactccactcg
gagatcacagctgccctgggccccagctcctgtgcccaccttccagccactgctctgtcc
cagctgcccctactaaaggctgtggtcaaggaggtgctgagactataccctgtggtacct
ggaaattcccgtgtcccagacaaagacattcatgtgggtgactacatcatccccaaaagt
acactggtcactctgtgtcactatgccacttctcgtgatcctgcccagttcccagagcca
aattcttttcgtccagctcgctggctgggggagggtccagccccccacccatttgcatct
ctcccctttggctttggcaagcgcagctgcatggggaaacgcctggcagagctccagcta
caaatggctttagcccagatcttgacccactttgaggtgcggcctgagccaggtgctgcc
ccaatcagacccatgacccggaccgtcctggtacccgagcggagcatcaacctacagttt
gtggacagatag

DBGET integrated database retrieval system