KEGG   Loxodonta africana (African savanna elephant): 100657914
Entry
100657914         CDS       T04351                                 

Gene name
MPP5
Definition
(RefSeq) MAGUK p55 subfamily member 5 isoform X1
  KO
K06091  MAGUK p55 subfamily member 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100657914 (MPP5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100657914 (MPP5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657914 (MPP5)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   100657914 (MPP5)
SSDB
Motif
Pfam: Guanylate_kin L27_N PDZ SH3_2 PDZ_6 L27 SH3_1 PDZ_2 SH3_9
Other DBs
NCBI-GeneID: 100657914
NCBI-ProteinID: XP_003408767
UniProt: G3TB89
LinkDB
Position
Unknown
AA seq 675 aa
MTTSYMNGHVTEESDNEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAVTVHMNKASPPF
PLISNAQDLVQEVQAVLKPVHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPITDE
RVYESVGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDILSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLIPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIVLIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRAQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLK
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgacaacatcctatatgaatgggcatgttacagaggaatcagacaacgaagtaaaaaat
gttgatcttgcatcaccagaggaacaccagaagcaccgagagatggctgttgactgccca
ggagatttgggcaccaggatgatgccagtacgtcgaagcgcacaattggaacgcattcgg
caacaacaggaagacatgaggcgtaggcgagaggaagaagggaagaaacaagaacttgac
cttaattcttccatgagacttaagaaactagcccaaattcctccaaagactggaatagat
aaccctatatttgatacagaagaaggaattgtcctagaaagtcctcattatgctgtgaaa
atattagaagtggaagacttgttttcttcacttaaacacatccaacatactttggtagat
tctcagagccaggaggatatttcactgcttttacaacttgtgcaaaataaagatttccag
aatgcatttaagatacacaacgctgtcacagtacatatgaacaaggccagtccaccattt
cctcttatctccaatgcacaagatcttgtacaagaggtacaagctgttttgaagccagtt
catcagaaggaagggcaagaattaactgccttgctgaatgccccgcatattcaggcactt
ttactggcccatgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtttatgaaagcgttgggcaatatggaggagaaactgtaaaaatagttcgtatagaa
aaggctcgcgatattccattgggtgctacagttcgtaatgaaatggattctgtcatcatt
agtcgaatagtaaaaggaggcgctgcagagaaaagtggtctgttacatgaaggagatgaa
gttctggagataaatggcattgaaattcggggaaaagatgtcaatgaggtttttgacata
ttgtctgatatgcatggtactttgacatttgtgctgattcccagtcaacagatcaagcct
cctcctgccaaggaaacagtaatccatgtaaaagctcattttgactatgacccctcagat
gacccctatgttccctgtcgagagttaggtctgtcttttcaaaaaggggatatacttcac
gtcatcagtcaagaagatccaaattggtggcaggcctaccgggaaggggatgaagataat
cagcccctagctgggctcattccagggaaaagctttcagcagcaaagagaagccatgaag
cagaccatagaagaagataaggagccagaaaaatcaggaaaactatggtgtgcaaagaag
aataaaaagaagaggaaaaaagttttatataatgccaataaaaatgatgattatgacaat
gaggagatcttaacttatgaggaaatgtcactttatcatcaacctgcaaataggaaaaga
cctatcgtcttgattggtccacagaactgtggccagaatgagttgcgtcagaggctcatg
aacaaagaaaaagaccgttttgcatccgcggtgcctcatacaactaggagtaggcgagac
catgaagtagctggtagagattaccactttgtttcacggcaagcattcgaagccgacata
gcagctgggaagttcatcgagcatggtgaatttgagaaaaatctgtatggaaccagcata
gattctgtacggcaagtgatcaactctggcaaaatatgtcttttaagtcttcgtgcacag
tcactgaagaccctccggaattcagacttgaaaccatacattatcttcattgcaccccct
tcacaagaaagacttcgggcattgctggccaaagagggcaagaatccaaagcctgaagag
ctgagagaaatcattgagaagactagagagatggagcagaacaatggccactactttgac
acagcaattgtgaattcagatcttgataaagcctatcaggagttgcttaggttaattaac
aaacttgatactgaacctcagtgggtgccatccacttggctgaagtga

DBGET integrated database retrieval system