KEGG   Loxodonta africana (African savanna elephant): 100657989
Entry
100657989         CDS       T04351                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657989 (ATF2)
   04668 TNF signaling pathway
    100657989 (ATF2)
   04022 cGMP-PKG signaling pathway
    100657989 (ATF2)
   04151 PI3K-Akt signaling pathway
    100657989 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100657989 (ATF2)
   04922 Glucagon signaling pathway
    100657989 (ATF2)
   04915 Estrogen signaling pathway
    100657989 (ATF2)
   04926 Relaxin signaling pathway
    100657989 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    100657989 (ATF2)
   04918 Thyroid hormone synthesis
    100657989 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100657989 (ATF2)
   04925 Aldosterone synthesis and secretion
    100657989 (ATF2)
   04927 Cortisol synthesis and secretion
    100657989 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100657989 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100657989 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100657989 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100657989 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100657989 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100657989 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100657989 (ATF2)
   05031 Amphetamine addiction
    100657989 (ATF2)
   05034 Alcoholism
    100657989 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657989 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657989 (ATF2)
   05161 Hepatitis B
    100657989 (ATF2)
   05163 Human cytomegalovirus infection
    100657989 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100657989 (ATF2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100657989 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 100657989
NCBI-ProteinID: XP_003406259
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLRVNPARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPATVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKSHSS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYRTADKDDSSEDISVPSSPHAEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacgtgtgaatcctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggattgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaatcgaggagccctctgttgtggaaacaactcaccaggatagtcctttacctcat
ccggagtccactaccagtgatgaaaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcgttacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcggtaccctcaccaacctcaagtactgtaatcacccag
gcaccatcctccaacaggccaattgtccctgtaccaggcccatttcctcttctgttgcat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttcctgccacagttccacttgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcttccccacaaccagttcagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggagacactgtcaaaagtcacagtagt
ggattagttaggactcaatcagaggaatctcgaccacaatcattacagcagccagccacg
tccactacagaaactccggcttctccagctcacacaactccacagacccaaaacacaagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaagtttctagag
agaaatagagcagcagcttcaagatgccgacaaaaaagaaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagctccttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcgtactgctgataaagatgacagttcagaagac
atttcagtgccaagtagtccacatgctgaagctatacagcatagttctgtcagcacatcc
aacggagtcagttcaacgtccaaggcagaagctgtagctacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcgcagattgtcatggctccttcctcgcagtcg
cagccctcaggaagttga

DBGET integrated database retrieval system