KEGG   Loxodonta africana (African savanna elephant): 100658035
Entry
100658035         CDS       T04351                                 

Gene name
GABARAP
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04371  Apelin signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04727  GABAergic synapse
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100658035 (GABARAP)
   04068 FoxO signaling pathway
    100658035 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100658035 (GABARAP)
   04136 Autophagy - other
    100658035 (GABARAP)
   04137 Mitophagy - animal
    100658035 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100658035 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    100658035 (GABARAP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100658035 (GABARAP)
   05022 Pathways of neurodegeneration - multiple diseases
    100658035 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658035 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658035 (GABARAP)
   04121 Ubiquitin system [BR:lav04121]
    100658035 (GABARAP)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100658035 (GABARAP)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100658035 (GABARAP)
Ubiquitin system [BR:lav04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100658035 (GABARAP)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100658035 (GABARAP)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 100658035
NCBI-ProteinID: XP_023412160
LinkDB
Position
Unknown
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtataaagaggagcatccgttcgaaaagcgccgctctgagggcgagaag
atccgaaagaaatatccggaccgggtcccggtgatagtagagaaggcccccaaagctcgg
ataggagatctggacaaaaagaaatacctggtgccttctgacctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaagatgccttgtttttctttgtc
aacaatgtcattccgcccaccagtgccacaatgggtcagctataccaggaacaccacgaa
gaagacttctttctatacattgcctacagtgatgaaagtgtctacggtctgtga

KEGG   Loxodonta africana (African savanna elephant): 100659994
Entry
100659994         CDS       T04351                                 

Gene name
GABARAPL1
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04371  Apelin signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04727  GABAergic synapse
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100659994 (GABARAPL1)
   04068 FoxO signaling pathway
    100659994 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100659994 (GABARAPL1)
   04136 Autophagy - other
    100659994 (GABARAPL1)
   04137 Mitophagy - animal
    100659994 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100659994 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    100659994 (GABARAPL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100659994 (GABARAPL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100659994 (GABARAPL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659994 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100659994 (GABARAPL1)
   04121 Ubiquitin system [BR:lav04121]
    100659994 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100659994 (GABARAPL1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100659994 (GABARAPL1)
Ubiquitin system [BR:lav04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100659994 (GABARAPL1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100659994 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 100659994
NCBI-ProteinID: XP_003410732
LinkDB
Position
Unknown
AA seq 126 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGNHTP
KRYLPL
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaagttccagtataaagaggaccatccctttgaatatcggaaaaaggaaggagaaaag
atccggaagaaatatccggacagggtccctgtgatcgtggagaaggctcctaaagccagg
gtgcctgacctggacaagaggaagtatctcgtgccctctgacctcaccgtgggccagttc
tatttcttaatccggaagaggatccacctccgacctgaggacgctttattcttctttgtc
aacaacaccatccctcccactagtgctaccatgggccagctgtatgaggacaaccatgag
gaggactattttctgtatgtggcctacagcgatgagagtgtctatgggaaccataccccc
aagcggtatctccctctgtag

KEGG   Loxodonta africana (African savanna elephant): 100675686
Entry
100675686         CDS       T04351                                 

Gene name
GABARAPL2
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04371  Apelin signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04727  GABAergic synapse
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100675686 (GABARAPL2)
   04068 FoxO signaling pathway
    100675686 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100675686 (GABARAPL2)
   04136 Autophagy - other
    100675686 (GABARAPL2)
   04137 Mitophagy - animal
    100675686 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100675686 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    100675686 (GABARAPL2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100675686 (GABARAPL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100675686 (GABARAPL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675686 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100675686 (GABARAPL2)
   04121 Ubiquitin system [BR:lav04121]
    100675686 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100675686 (GABARAPL2)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100675686 (GABARAPL2)
Ubiquitin system [BR:lav04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100675686 (GABARAPL2)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100675686 (GABARAPL2)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 100675686
NCBI-ProteinID: XP_023412277
LinkDB
Position
Unknown
AA seq 144 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVSVRPPPPPHLAVTRAPTLCSSIVLTIQGQ
SLTLEIQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQ
LYEKEKDEDGFLYVAYSGENTFGF
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactcgttggaacacagatgcgtggaatccgcgaaa
atccgagcaaaatatcccgaccgggttccggtgagtgttcggcctcccccgccccctcac
ctcgctgtcacccgtgcccccacactctgttcatcaattgtcctgacaattcagggccag
agcctcactttagaaatccaaattgttgacattgacaaacggaagtacctggttccatct
gacatcactgtggctcagttcatgtggatcatcaggaaaaggatccagcttccttctgaa
aaggctatcttcctttttgtggataagacagtcccacaatccagcctaactatgggacag
ctttacgagaaggaaaaagatgaagatggattcttgtatgtggcctacagcggagagaac
acttttggcttctga

DBGET integrated database retrieval system