KEGG   Loxodonta africana (African savanna elephant): 100658069
Entry
100658069         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: steroid 21-hydroxylase
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00140  Steroid hormone biosynthesis
lav01100  Metabolic pathways
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Module
lav_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100658069
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100658069
   04927 Cortisol synthesis and secretion
    100658069
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100658069
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100658069
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP21 family
   100658069
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100658069
NCBI-ProteinID: XP_023397121
LinkDB
Position
Unknown
AA seq 494 aa
MLLLGLLLLLPLLAAARLLWGWWMLRTLRLPPLVPGFLHLLQPNLPFYLLGLPQKLGPVY
XALGLQEVVVLNSKRAIEEAMVKKWVDFAGRPQTPSYKLVSLDYQDVSVGDYSLLWKAHK
KLTRSALLLGIRSSMEPLVQELTQEFCERMRAQAGAPVAIYKELSLLTCTIICYLIFGDK
QEDSLVRAFHDCVQDLLSTWDHWSIQILDIVPFLRVLPTPGLWRMKRALEKRDHMVKEQL
RRHKDSLVAGQCRDMMDYMLQGLRKHSMEEGSTGELRESHVHMSTVDLFIGGTDTTATTL
SWAVTFLLHHPEIQQRLQEELDRELGPSTSNSWIKYKDRARLPLLNATIEEVLRLRSSVP
LALPHRTTRPSSILGYDIPEGMVVIPNLLGSHLDETVWERPHEFWPERFLEPGAHPSALP
FGCGARVCLGEPLARLEIFVVLMQLLRAFTLLPAAGALPSLQPRPHCAVSLQTQPFQVRL
QPRGAGAPGLGESQ
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgctcctggggctgctgctgctgctgcccctgctggctgctgcccgcctgctatgg
ggctggtggatgcttaggaccctccgcctcccaccgctcgtcccgggcttcctgcacctg
ctgcagcccaatcttcccttctacctgcttggcctgcctcagaaactcgggcctgtctac
nntgccctggggctgcaagaggtggtggtgctgaactccaagagggccattgaggaggcc
atggtcaagaagtgggtggactttgctggcagaccccagacaccatcctataagctggtg
tctctggactaccaggatgtgtcagtaggggactactccctgctctggaaggcccacaag
aagctcacccgctcagctctgctgctgggtatccgaagctccatggagcctcttgtgcag
gagctgacccaggagttctgtgagcgcatgagagcccaggctggtgcccccgtggccatc
tataaggaactatccttgctcacctgtaccatcatctgctacctcatttttggagacaag
caggaggactctctagtgcgtgcctttcatgactgcgtccaggacttgttaagtacctgg
gaccactggtccatccaaattttggacattgttccctttctcagggttcttcccacccca
ggtctgtggaggatgaagcgggccttggagaagagagaccacatggtgaaggagcagctg
aggcggcacaaggacagcctggtggccggccagtgcagggacatgatggactacatgctg
caagggctgaggaagcacagcatggaagagggcagcacaggggagctccgtgaaagccac
gtgcacatgtctacagtggacctgttcatcggtggcacggacaccacagcaaccaccctc
tcctgggcagtgacgttcttgcttcaccaccctgagattcagcagcgactgcaggaggag
ctggatcgtgagctgggccctagtacctcgaactcctggatcaagtataaggatcgtgcg
cggctgcccttgctcaacgctaccatcgaggaggtgcttcgcctgcggtcctctgtgccc
ctggccttgccccaccgcaccacgcggcccagcagcatcctgggctacgacattcccgag
ggcatggtcgtcatccccaacctcctaggctcccatctcgacgagacggtctgggagcgg
ccgcacgagttctggcccgagcgcttcctggagcctggcgcgcaccccagcgcgctgccc
ttcggttgcggcgcgcgcgtgtgcctaggggagccgctggcgcgcctcgagatctttgtg
gtgctgatgcagctgctccgggctttcacgctgctgccggccgccggcgccctgccctcg
ctgcagccccggccccactgtgccgtctccctccagacgcagcctttccaggtgcggctg
cagccccggggcgccggtgcacctggcctgggagagagccaatga

DBGET integrated database retrieval system