KEGG   Loxodonta africana (African savanna elephant): 100658076Help
Entry
100658076         CDS       T04351                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav05152  Tuberculosis
lav05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100658076 (CARD9)
   04625 C-type lectin receptor signaling pathway
    100658076 (CARD9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100658076 (CARD9)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100658076 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD
Motif
Other DBs
NCBI-GeneID: 100658076
NCBI-ProteinID: XP_023397738
LinkDB All DBs
Position
Unknown
AA seq 700 aa AA seqDB search
MVGKTPVFSTRLSSENSTRTSPLGELGRAMSPCRESSTHQEVPGPRLHPPWAPGCGSIPH
VRASAGWRAALSTQRTQATGVSSPAMSDYENEDECWSALEGFRVKLISVIDPSRITPYLR
QCKVLNPDDEEQVLSDPSLVIRKRKVGVLLDILQRTGHRGYVAFLESLELYYPQLYKKVT
GKEPARVFSMIIDASGESGLTQLLMSEVLKLQKKVQELTALLTSKDDFAEELRVKDSLLR
KHQERVQRLKEECEALGRELKRCKEENHDLALRLARQSEEKGAALMRNRDLQLEVDRLKH
SLMKAEDDCTVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQGLEASAQDRRRDR
SGTYIQVLEEDWRQALRDHQEQASIIFSLRKDLRQAEAQRARCVEEKEMFELQCLALRKD
SKMYKDRIEAVLQQMEEVAIERDQAVVTREELHTQQARCLQEKDRLRKRIRELGEKADEL
QLQLFQREGQLLAAEGRLKRQQLETLVLSSDLEDSSPRSSWEVSGPPGGCRAGPPEAHSW
QPPTGPLGHARHPACSRNWRGVVWVAAPPSRSGEGPRRSCETGPRTCCRIQGEAMEGPCG
PESQPWAGLTGMTLLPGGPAEGQSLEQPLVALQKEQLSLTPNGTGLSGGEPPEKERRRLK
ESFENYRRKRALRKMQNGLRQGEVDWENTTGSDNTDTEGS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggtagggaagactccagtattttccacgcggctttcctctgagaacagcactcgcact
tccccactgggtgaattggggcgggccatgtctccctgcagggagagcagcacccaccag
gaagtgccggggcctcggctccaccctccctgggcaccaggctgcggcagcatcccacac
gtcagagcctcagccggctggcgggcagcactcagcacacagaggacccaggccactggc
gtgtcctctcccgccatgtcggactatgagaacgaggatgagtgctggagcgccctggag
ggttttcgggtgaagctcatctcagtcatcgacccctcccgcatcaccccgtacctgcgc
cagtgcaaagtcctcaaccctgacgacgaggagcaggtgctcagcgaccccagcctggtc
atccgcaagcgcaaagtgggcgtcctcctggacatcctgcagcggacgggccacaggggc
tacgtggccttcctggagagcctggagctctactacccacagctgtacaagaaggtcact
ggcaaggagccggcccgcgtcttctccatgatcatagacgcctcgggggagtcgggcctg
acgcagctgctgatgagcgaggtgctaaagctgcagaagaaggtgcaggagctgacggcg
ctgctgacctccaaggacgacttcgccgaggagctgcgggtcaaggacagcctgcttcgc
aagcaccaggagcgcgtgcagcggctgaaggaggagtgcgaagccctcgggcgtgagctc
aagcgctgcaaggaggagaaccacgacctggccctgcggctggcacgtcagagtgaggag
aagggcgcggccctcatgcgcaaccgcgacctgcagctggaggtggaccggctcaagcac
agtctcatgaaggcagaagacgactgcacggtggaacgcaagcacacgctgaagctgcgg
cacgccatggagcagcggcccagccaggagctgctgtgggagctgcagcaggagaaggcc
ctgctgcaggcccgagtgcaggggctggaggcctccgcccaggacaggaggcgggacagg
agcggcacctacatccaggtgctggaggaggactggaggcaggccctgcgtgaccaccag
gagcaggccagcatcatcttctccctgcgcaaggacctgcgccaggccgaggcccagcgg
gccaggtgcgtggaggagaaggagatgttcgagctacagtgcctggccctgcgcaaggac
tccaagatgtacaaggaccgcatcgaggctgtcctgcagcagatggaggaggtggccatt
gagagggatcaggccgtggtgactcgagaggagctgcacacgcagcaggcacggtgcctg
caggagaaggacaggctgcggaagcgtatccgcgagctgggcgagaaggcagatgagctc
cagctgcagctgttccagcgtgagggccagctgctggccgcggagggccgcctaaaacga
cagcagctggagacacttgtcctgagctccgacctggaggacagctctcctaggagctcc
tgggaggtgagtgggccgccaggtgggtgccgggctgggccccctgaggctcacagctgg
cagcctcccaccggaccgctgggccacgcccggcaccccgcctgctctaggaactggcga
ggtgtggtgtgggtagctgctcctccttcgcgctctggtgagggtcccaggagatcttgt
gagactggccccagaacgtgctgcagaatccagggtgaggcgatggagggcccgtgtggc
ccagagtcccagccgtgggcagggctgacaggcatgactctgcttccaggtggcccggct
gaggggcagagcttggagcaacccttggtggctctacagaaggagcagctttcactgacc
cccaacggcacaggactgagtggcggggagccccctgagaaggagcgtcggcggctcaag
gagagcttcgagaactaccgcaggaagcgggccctccgcaagatgcagaacggcctgcgg
cagggggaggtggactgggagaacaccaccggcagcgacaacacggacacggagggctcc
tag

DBGET integrated database retrieval system