KEGG   Loxodonta africana (African savanna elephant): 100658078Help
Entry
100658078         CDS       T04351                                 

Definition
(RefSeq) olfactory receptor 8S1-like
  KO
K04257  olfactory receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100658078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100658078
G protein-coupled receptors [BR:lav04030]
 Others
  Chemoreception
   Olfactory
    100658078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 100658078
NCBI-ProteinID: XP_003405444
LinkDB All DBs
Position
Unknown
AA seq 335 aa AA seqDB search
MEFMNNLTVFTEFILLGLSAKPYLQVLLFVLFLLIYLLTLLGNLVMILVIRADSHLHTPM
YFFLGHLSFLDLSFSSVTVPKMLQHFLYLKKSISVWGCITQSFFLTLSGSTEACLLSAMA
YDRYIAVCHPLLYTVVMNRPLCTAMVSAAWGMGFLNSLINNLFSRKLHFCGSNIISHFSC
ELPSLFLLSCTDPTANKLLLSGSTTFLGLLTFPLIIFSYSRIISAILSIPSSGGQGKAFS
TCSSHLTVVLLFYGTALFRYISPPSGSLLERVVSIQHTVITSLLNPVIYSLKNQEVKAAL
QRMLRQKMSSSEEGISVWCSVREWGEGIFRNRNTF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaatttatgaacaacctcactgtcttcactgagttcatcctcctcggactgtctgct
aaaccctaccttcaggttctgctcttcgtgctcttcctgttgatttacctcctgaccttg
ctggggaacctggtgatgatcctggtgattagagctgattctcacctccacacccccatg
tacttctttcttggacatctgtccttcctggatctcagcttctcctcagtcaccgtgccc
aaaatgctgcagcacttcctgtatctgaagaaaagcatctcagtgtggggctgcatcacc
cagagtttctttctcactctctctgggagtaccgaagcctgtctgctctctgccatggcc
tatgaccgctacatcgctgtctgccaccctctgctctacaccgtggtcatgaacaggcct
ctctgcactgcaatggtcagtgcagcatgggggatggggtttctgaactcactaataaat
aatcttttcagccgcaagttacatttctgtgggtccaacatcatctcccacttcagctgt
gagctgccatcactgttcctgctgtcctgcactgatcccactgccaacaagttgcttctc
tctgggtcaactacatttctggggctgctgacatttcccctgatcatcttctcttactcc
agaatcatctctgccatcctgagcatcccctcctctggaggccaaggcaaagccttctct
acctgctcctcccacctcaccgtggtgctcttgttctatgggacagctctcttcaggtac
atcagccctccttcaggctcattgttggagcgagtagtctccattcagcacactgtgatc
acatccttgctgaaccctgtcatctacagcctcaagaatcaggaggtaaaagcagctctg
cagaggatgctgaggcagaaaatgtcttcctcagaagagggcatctctgtgtggtgttca
gtcagagaatggggagaagggatcttcagaaacagaaacaccttctga

DBGET integrated database retrieval system