KEGG   Loxodonta africana (African savanna elephant): 100658131
Entry
100658131         CDS       T04351                                 

Gene name
PGR
Definition
(RefSeq) LOW QUALITY PROTEIN: progesterone receptor
  KO
K08556  progesterone receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100658131 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100658131 (PGR)
   04914 Progesterone-mediated oocyte maturation
    100658131 (PGR)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    100658131 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100658131 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100658131 (PGR)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100658131 (PGR)
Nuclear receptors [BR:lav03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100658131 (PGR)
SSDB
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100658131
NCBI-ProteinID: XP_003415644
LinkDB
Position
Unknown
AA seq 941 aa
MTEPKAKDPRAPHVAGGAPSPTQVRSPLLGRSDAGPFQESQTSDDPPVASAIPISLDGLL
FPQPCQGQNPPEASTPNQQPLSDVEDPYPGAEAAGGAGGRSSRPPKKDSGLLDSVLDTLL
ATPGPGHSHASPPACEATSPWCMFSPELPEDPRAAPATQGALPLLMSRPGGKVGDHSGAA
APHKVMHRELSPSQQLLPPTPGGPQWPGAPVKPSPQPSMVEAEEEDGSESQGSASPLLKG
KPRALGSTAAGGGAAATAPGATAGSVALVPKEDSRFLASRVTLAEQDAPAAPARSPMATT
VVDFIHVPIVPLNPAFLAARTRTRQLLEGESYDSGAAVASAFVPPRGSPSASSTPGAGVD
FPDCAYPPDAEPKGDVFPLYGDFQPPALKIKEEEEGAEAALRPPRPYLXAGSQASAFPDF
QLAPPPPHLPPPRAPSSRPAEALLAATAASASISSASSSGSTLECILYKAEGAPPQQSPF
ATPPCKAPGAGVCLHPRDGLPSTSAASAAVAAAGAVPALYPPLGLNGIPQLGYQAAVLKE
GLPQVYPPYLNYLRTDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFK
RAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALD
AVALPQPVGMPNESQTLSQRITFSPSQELQFVPPLINLLVSIEPDMIYAGHDNTKPDTSS
SLLTSLNQLAERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVS
GQMLYFAPDLILNEQRMKESSFYPLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPL
EGLRSQNQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCL
NTFIQSRALCVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgactgagccgaaggcaaaggatcctcgggctcctcacgtggcgggcggcgcgccctcc
ccaacccaggttagatcccccctgctgggtcgctccgatgctggccccttccaggagagc
cagacctcggacgacccgccggtagcctcggcaatacccatctccctggacgggctgctc
ttccctcagccctgccagggacaaaacccccccgaagcgagcacgccgaaccagcagccg
ctgtcggacgtggaggacccatatcccggagcggaagccgcagggggtgctggaggacgc
agctctagaccccccaaaaaggacagtgggctgctggacagcgtcttagacacgttgctg
gcgacccccggtcctggacacagccacgccagccctcctgcctgcgaggcaaccagccct
tggtgcatgtttagccctgagcttcccgaagaccctcgtgctgctcccgccacccagggg
gcgttgcctttgctcatgagtcggcccgggggcaaggttggcgaccactcaggggcggcg
gcaccccacaaggtgatgcacagggagctgtcgccgtcccagcagctgctgcctccgact
cctgggggccctcagtggcccggggcccctgtgaagccgtctccgcagccttctatggtg
gaggccgaggaggaggatggctccgagtcccagggctccgcgagtccgcttctgaaaggc
aaaccccgggctctgggaagcacagcggccggaggaggagccgcggccactgcgcctggg
gcgaccgcaggaagcgtcgccctcgtacccaaggaagattcccgctttttggcgtccagg
gtcaccctggcggagcaggatgcgccggcggcgcccgcgcgctccccgatggccaccacg
gtggtggatttcatccacgtgcccatcgtgccgctcaacccggccttcctggcagcccgc
actcggacccggcagttgctggagggggagagctacgacagcggtgccgcggtcgccagc
gccttcgtcccgccaaggggctcgccctcggcctcgtccacccccggcgccggcgtcgac
ttccccgactgcgcatacccgccggacgctgagcccaagggtgacgttttcccgctctac
ggcgactttcagccgccagccctgaagatcaaggaggaggaagaaggagccgaggccgcc
ttgcgccccccgcgtccctacctgnntgccggttcccaagcctccgccttcccggatttc
cagctggcgccaccgccgccgcatctgccgccgccgcgagcaccgtcgtccagacccgcg
gaagcgctattggcggcgacggccgccagtgcctccatctcgtctgcgtcctcgtcgggg
tcgaccctagagtgcatcctgtacaaagcggagggcgcgccgccccagcagagtccgttc
gcgacgccgccctgcaaggcgcctggcgctggcgtctgcctgcacccgcgagacggcttg
ccctccacctcggccgcctcagccgccgtcgccgccgccggggcggtccccgcgctctat
ccgccgctcggcctcaacgggatcccgcagctcggctaccaggccgctgtgctcaaggag
ggccttccgcaggtgtacccgccgtatctcaactacctgaggacggattcagaagccagc
cagagcccacagtacagcttcgagtcattacctcagaaaatttgtttaatctgtggggat
gaagcctcaggctgtcattatggcgtccttacctgtgggagctgtaaggtcttctttaaa
agggcgatggaagggcagcataactatttatgtgctggaagaaatgactgcattgttgat
aaaatccgcagaaaaaactgtccagcatgtcgccttagaaagtgctgtcaggctggcatg
gtccttggaggtcgaaagtttaaaaagttcaataaagtcagagttatgagagctctagat
gctgttgctctcccacagccagtgggcatgccaaatgaaagccaaactctaagccagaga
atcactttttcaccaagtcaagaactacagtttgttcccccactgatcaatctgttagtg
agcattgaaccagatatgatctatgcaggacatgacaacacaaaacctgacacctccagt
tctttgctgacgagtcttaatcaactagccgagaggcaacttctttcggtagtcaagtgg
tctaaatccctgccaggttttcgaaacttacatattgatgaccagataactctcatccag
tattcttggatgagtttaatggtgtttggactaggatggcgatcctataaacacgtcagt
gggcagatgctgtattttgcacctgatttaatactaaatgagcagcggatgaaggaatcc
tcattctatccattatgccttaccatgtggcagatcccacaggagtttgtcaagcttcaa
gttagccaagaagagttcctctgtatgaaagtattgctacttcttaatacaattcctttg
gaaggactaagaagtcaaaaccagtttgaagagatgagatcaagctacattagagaactc
atcaaggcaattggtttgagacaaaaaggagttgtctctagctcacagcgtttctatcag
cttacaaaacttcttgataacttgcacgatcttgtcaaacaacttcatctgtactgcttg
aatacctttatccagtcccgggcactgtgtgttgaatttccagaaatgatgtctgaagtt
attgctgcacagttacccaagatcttggcagggatggtgaaaccacttctctttcataaa
aagtga

DBGET integrated database retrieval system