KEGG   Loxodonta africana (African savanna elephant): 100658178Help
Entry
100658178         CDS       T04351                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04910  Insulin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100658178 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100658178 (GYS2)
   04152 AMPK signaling pathway
    100658178 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100658178 (GYS2)
   04922 Glucagon signaling pathway
    100658178 (GYS2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    100658178 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lav01003]
    100658178 (GYS2)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100658178 (GYS2)
Glycosyltransferases [BR:lav01003]
 Polysaccharide
  Storage polysaccharide
   100658178 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100658178
NCBI-ProteinID: XP_003405733
UniProt: G3SMP7
LinkDB All DBs
Position
Unknown
AA seq 702 aa AA seqDB search
MLRGRSLSVTSVSGLPRWEVEELPVEDLLLFEVAWEVANKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFENNMKTQVEQCEPVNETVRRAVDTMNNHGCQVHFGRWLIEGSPYVVLFDI
GSSAWNLDRWKGDLWEACCVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLKGEIPDMNNIL
DRDDLTIMKRAIFSTQRHSLPPVTTHNMIDDATDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFCSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LVRYYQHARHLTLSRAFPDKFHMEPTAPPTTEGFKYPRPPSVPPSPSGSQASSPQSSDVE
DDEDERYNEEEEAERDRLNFKSPFSLGQVPHGKKKLHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctccggggcagatctctatctgtgacatccgtgagcgggcttcctcggtgggaagtt
gaagaacttcctgtggaggatttactgctctttgaagttgcttgggaagtggccaataaa
gttggtggcatctatactgtgattcagacaaaggctaagacaacagcagatgaatgggga
gaaaattatttcctgataggtccatattttgagaataatatgaagactcaggtggaacag
tgtgaacctgtaaatgagactgttcgaagagcagtggacacaatgaacaatcacggatgc
caggtgcattttggaagatggctgatagaagggagtccttacgtggtgctctttgacatc
ggctcttcagcttggaatctggacaggtggaagggtgacctttgggaagcatgttgtgtt
ggcatcccttatcatgaccgagaagccaatgacatgctgatattcggatctttaactgcc
tggttcttaaaagaggtgacagatcacgcggatggtaaacacgtcattgcccagttccat
gaatggcaggccggaattggactgattctttcccgagcccggaaacttcctattgccaca
atattcaccacccacgccactctgcttgggaggtacctatgtgcagcaaacattgatttc
tacaaccatctcgataagtttgacatagacaaagaggccggggaaaggcagatttaccac
cggtattgcatggagcgagcctctgttcattgtgctcatgtgttcaccaccgtttctgaa
ataacagcaatagaagcagaacacatgctgaagagaaaacctgatgtcattactccaaat
ggcttgaatgttaagaaattttcagcagtacatgagtttcaaaatctgcatgccatgtat
aaggccaggatccaagattttgttcgaggtcatttctacggtcaccttgactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatctttatccaggctaaatttcctgctgaggatgcataaaagtgacgtc
acagttgtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctg
aaaggacaggcagtgcgaaaacagctatgggacactgcacattctgtgaaggaaaagttt
ggaaagaaactctatgatgcattattaaaaggagaaattcctgacatgaacaatattctg
gatcgagatgatctaacgattatgaaaagagccatcttttcaactcagcgacattctttg
cctccagtgaccactcacaacatgattgacgatgccacggatcccatcctcagcaccatt
agacgtatcggacttttcaacagccgcacagacagagtcaaggtgattttgcacccagag
ttcctatcctccaccagcccgttattgcccatggattatgaagagtttgtcagaggctgt
catctcggggtatttccatcatactatgaaccctggggctataccccagctgaatgcact
gtgatgggtatccccagtgtgacaacaaacctctctggctttggctgtttcatgcaggag
cacgtggctgatcctactgcatatggtatttacattgttgacaggaggttctgttctcca
gatgattcttgcaaccagctgacgaagtttctctatggattttgcaaacagtcacgccgc
caaagaattatccagagaaaccgaactgagaggctctcagatcttctggattggagatac
ttagtcagatattaccagcacgccaggcatctgacattgagcagagcttttccagataaa
ttccatatggaaccaacagcaccaccaacgacagagggatttaaatacccgaggcctccc
tcagtaccaccttctccttcagggtctcaggcctccagccctcagagcagtgatgtggaa
gatgatgaggatgagagatacaatgaggaagaggaggctgaaagggatcggttgaatttc
aagtcgccattttctctgggtcaagttcctcatggcaagaaaaagctacatggtgaatat
aagaactga

DBGET integrated database retrieval system