KEGG   Loxodonta africana (African savanna elephant): 100658206
Entry
100658206         CDS       T04351                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4 isoform X1
  KO
K10127  protein Mdm4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100658206 (MDM4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100658206 (MDM4)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100658206 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 Cript DZR
Other DBs
NCBI-GeneID: 100658206
NCBI-ProteinID: XP_003410297
UniProt: G3SPY8
LinkDB
Position
Unknown
AA seq 491 aa
MTSLSTSVQCASSASACRLSAEHITQVRPKLPLLKILHAAGAQGEMFTVKEVMQYLGQYI
MMKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKEPSPLYDMLRKNLVTLATPAADAAQTL
ALAQDHSMDIPSQDQLKQRGEESVSSRKRTEEGSVPVLPTSQHNCRNSREDEDLIENLSP
NKKSGLDLGFEEWDVAGLPWWFLGNLRNNYTPRSNGSTDLQTNQDIGTALVSDTTDDLWF
LNDSVSEQLGVGIKAEAADTEQTSEEVGKVNEKKVIEVEKNDDFEDSKSLSDDTDIEVTS
EDEWQCTECKKYNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKKENEGIDV
PDCRRTISAPVVRPKDGYIKEGNAKPLDPCSSVDFLDLAHSTESQETTSSMGEQSDNLYE
QRTDAENMEDCQTLLKPCSLCEKRPRDGNIIHGRTGHLATCFHCARRLKKAGASCPICKK
EIQLVIKVFIA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgacgtccctttccacctccgtccagtgtgcgtcatctgccagtgcttgcaggctctct
gcagaacacatcactcaggtacgaccaaaactgccacttttgaagattttgcatgcagca
ggtgcacagggtgagatgttcactgttaaagaggtcatgcagtatctaggccagtatata
atgatgaagcagctttatgatcagcaggagcagcacatggtttattgtggtggagatctt
ttgggagaactgctaggacgtcagagcttctccgtgaaagagccaagccctctctatgat
atgctaagaaagaaccttgtcactttagccactcctgctgcagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagccaagaccaactgaagcaacgtgga
gaggagagtgtgagctccaggaaaagaaccgaagaaggcagtgttcccgtgctgcctacc
tcacagcataactgcagaaattcaagagaagacgaagacttgatagaaaatttaagccca
aataagaaatctggcctggacctcgggtttgaggagtgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaaacaactatacacctagaagtaatggctcaactgattta
cagacaaatcaggatataggtactgcccttgtttcagacactacagatgacttgtggttt
ttgaatgattcagtatcagagcagttaggtgttggaataaaagctgaagctgctgatact
gaacaaacaagtgaagaagtagggaaagtgaatgagaaaaaggtgattgaagtggaaaag
aatgacgactttgaggactctaagtccttaagcgatgatactgatatagaagttacctct
gaggatgagtggcagtgtactgagtgcaagaaatataactctccaagcaagaggtactgt
ttccgttgctgggccttgaggaaggattggtattcggattgttcaaagttaacccattct
ctgtccacctctgatatcactgccatacctgaaaagaaggaaaatgaaggaattgatgtg
cctgattgccgaagaaccatttcagctccagttgttagacctaaagatggatacataaag
gaaggaaacgccaaacctcttgatccctgcagctcagtggacttcttggatttggctcac
agcactgaaagccaagagaccacctcaagcatgggagagcagtcagataacctgtatgaa
caaaggacagatgcagaaaacatggaggattgccagactctcttgaagccatgtagctta
tgtgagaaaaggccacgagacgggaatatcattcatgggaggacaggtcatcttgccacg
tgctttcactgtgccagaagattaaagaaggcaggggcttcttgccctatttgcaagaaa
gagattcagttggttattaaggtttttatagcgtag

DBGET integrated database retrieval system