KEGG   Loxodonta africana (African savanna elephant): 100658232
Entry
100658232         CDS       T04351                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type protein 3 isoform X1
  KO
K10137  zinc finger, matrin type 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100658232 (ZMAT3)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 100658232
NCBI-ProteinID: XP_010594316
UniProt: G3SMJ9
LinkDB
Position
Unknown
AA seq 289 aa
MILLQHAGLPPPKRPSSSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEGLPKGGDQD
SALEDLCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPTRMSNAVEPA
ATPVVSVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSDSSEVGQRRARKEGNEYKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccgggcttcctccacctaagcggccctcgtcctctcctcct
atgtcagtggccaccaggtctacaggaaccttgcagcttccgccacagaagccttttggg
caggaggcttccttgcctctggcaggggaagaagggttacctaagggaggggatcaagac
tctgccctggaggacctctgtaagcccctgtactgcaagctctgcaatgtcaccttgaac
tcagcacagcaagcccaggctcattatcagggtaaaaaccatggtaagaaactccgaaat
tactatgctgcgaatagctgtcctcctcctaccaggatgagcaatgcagtggagcctgcg
gctactccagttgtttcagtccctccgcagatgggctcctttaagccaggaggccgagtg
atcctggccacagagaacgattactgtaagctctgtgatgcctcctttagttctccggca
gtggcccaggctcactatcaagggaagaatcatgccaagaggctgcggctggcggaagct
cagagtaactcattctcggactcctcagaggtgggtcagcggagggccaggaaagaaggg
aatgaatataaaatgatgcctaataggagaaatatgtatacggtacagaacaattcagca
ggtccttacttcaacccccgctcccggcagagaattccgcgtgacctggccatgtgcgtt
actcccagcggccagttttactgctccatgtgtaatgttggggctggcgaagagatggaa
ttccggcagcatttagaaagcaagcaacataaaagcaaggtgtctgaacagcggtacagg
aatgagatggagaacctgggctatgtatag

DBGET integrated database retrieval system