KEGG   Loxodonta africana (African savanna elephant): 100658238
Entry
100658238         CDS       T04351                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav00520  Amino sugar and nucleotide sugar metabolism
lav00524  Neomycin, kanamycin and gentamicin biosynthesis
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav04910  Insulin signaling pathway
lav04911  Insulin secretion
lav04917  Prolactin signaling pathway
lav04922  Glucagon signaling pathway
lav04930  Type II diabetes mellitus
lav04950  Maturity onset diabetes of the young
lav05230  Central carbon metabolism in cancer
Module
lav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lav_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
lav_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100658238 (GCK)
   00052 Galactose metabolism
    100658238 (GCK)
   00500 Starch and sucrose metabolism
    100658238 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100658238 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100658238 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100658238 (GCK)
   04910 Insulin signaling pathway
    100658238 (GCK)
   04922 Glucagon signaling pathway
    100658238 (GCK)
   04917 Prolactin signaling pathway
    100658238 (GCK)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100658238 (GCK)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100658238 (GCK)
   04950 Maturity onset diabetes of the young
    100658238 (GCK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100658238 (GCK)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 100658238
NCBI-ProteinID: XP_023414384
LinkDB
Position
Unknown
AA seq 495 aa
MRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGE
GETGQWSIKTKHQMYSIPDDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFP
VRHEDIDKGILLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISC
YYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGNEGRMCVNTEWGGFGDSGELDEFLLEY
DRVVDETSMNPGQQLYEKLIGGKYMGELVRLVLLKLADENLLFHGKTSEQLRTRGAFETR
FVSQVESDSGDRKQIYNILSTLGLRASATDCDIVRLACESVSTRAAQMCSAGLAGVINRM
RESRSEEVMHITVGVDGSVYKLHPSFKERFHASVRRLTPSCEITFIQSEEGSGRGAALIS
PGGASSLSTSAVLLGWPGAELDLQEGWSQPSVKDKTLRPNLGGLWSPGGGSFMLHLQRAD
FEPPLLSAGLRINRI
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaggcggatgcagaaggagatggaccgtggcctgagactggagacccatgaggaggcc
agcgtgaagatgctgcccacttacgtgcgctctaccccagagggctcagaagtcggggac
ttcctctccctggatctgggcggcaccaacttcagggtgatgctggtgaaggtgggcgaa
ggtgagacagggcagtggagcatcaaaaccaagcaccagatgtactccatccctgacgac
gccatgacaggcactgcggagatgctctttgactatatctccgagtgcatatccgacttc
ttggacaagcatcagatgaagcacaagaagttgcctttgggctttaccttctcctttcct
gtgaggcatgaagacatcgacaagggcatccttctcaactggacaaagggcttcaaggcc
tcaggagcagaagggaacaacattgtagggcttctgagagacgccatcaaacggagaggg
gactttgagatggacgtggttgcaatggtgaatgacactgtggccaccatgatctcctgt
tactacgaagaccaccagtgtgaggtcggcatgattgtgggcacaggctgcaacgcctgc
tacatggaggagatgcagaacgtggagctggtggaggggaacgagggccgcatgtgcgtc
aacaccgagtggggtggcttcggcgactcaggcgagctggacgagtttctgctggagtat
gaccgcgtggtggatgagacctccatgaaccccggtcagcagctatacgagaagcttatc
ggcggcaagtacatgggcgagttggtgcgccttgtgctgctgaagctcgcggacgagaac
ctactgtttcacggcaagacctcagagcagctgcgcacgcgcggggccttcgagacgcgc
tttgtctcgcaggtggagagcgactcgggcgaccgcaagcagatctacaacatcctgagc
accctggggctgcgcgcctcggccaccgactgcgacatcgtgcgcctagcctgcgagagc
gtgtccacgcgcgccgcgcagatgtgctcggccgggctggcgggcgtcatcaaccgcatg
cgcgagagccgcagcgaggaggtgatgcacatcaccgtgggcgtggacggctccgtgtac
aagctgcatcccagcttcaaggaacgcttccacgccagcgtacggagacttacgcccagc
tgcgagatcacctttatccagtcggaggagggcagcggccggggggcggcgctcatctcc
ccaggcggggccagcagcctttcaacctctgctgtcctgttgggctggccaggtgctgag
ctggacctgcaggagggatggtcccagccctctgtgaaggacaagacactgaggccaaat
ttaggaggtctgtggtccccaggtgggggatccttcatgctgcatctgcaacgggcagac
tttgagcctcctctgctctcagctggacttcgcatcaaccggatctaa

DBGET integrated database retrieval system