KEGG   Loxodonta africana (African savanna elephant): 100658307
Entry
100658307         CDS       T04351                                 

Gene name
BEST2
Definition
(RefSeq) LOW QUALITY PROTEIN: bestrophin-2
  KO
K13879  bestrophin-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100658307 (BEST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100658307 (BEST2)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100658307 (BEST2)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 100658307
NCBI-ProteinID: XP_023407651
LinkDB
Position
Unknown
AA seq 478 aa
MTVTYTARVANTRFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFVLSEEQKR
YFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWDQYLCMPLPDALMCMVAGTVHGRDER
GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTVDHVVEAGFMTREERKKFENLNSSYNK
FWVPCVWFCNLAAQARREGRIRDNSALKLLLEELNTFRAKCGMLFHYDWISIPLVYTQVV
TIAVYSYFLACLIGRQFLDPAQGYKGHDXDLCVPIFTLLQFFLRMRPGSGVRSQVFWDMW
GQKAGMEPGEAACLGPRCVNQGRGALPQRLLGCRSRSLAKEDMQFQRLDGVDGPLGETHG
DFLQRLLPVAAGTAGGLLGRRLSMLLRKNSGVSEASIVASCACATAPDGAAQDCSCEDPL
LDPGLREPEPELPAGPELPVPAPGPAAEPFTLVPMPGPRGPAPPWLPSPIGEEEENLA
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaccgtcacgtacacagctcgcgtggcaaacacgcgctttggcggcttctcgcagctc
ctactgctgtggcgcgggagcatctacaagcttctgtggcgcgagctgctctgcttcctg
gggctctacatggcgctgagcgctgcctaccgctttgtgctgagtgaagagcagaagcgc
tactttgagaagctcgtcatttactgcgaccagtacgccagcctcatcccagtttccttc
gtactcggcttctacgtgacgctggtggtgcaccgctggtgggaccagtacctctgcatg
ccgctgcccgacgcgctcatgtgtatggttgcgggcaccgtccacgggcgcgatgagcgc
ggtcgcctctaccggcgtacgcttatgcgttacgcaggactctccgccgtgctcatcctg
cgctcggtcagcaccgccgttttcaagcgcttccccaccgtggaccatgtagtagaggct
gggtttatgacccgcgaagagcgcaaaaagttcgagaacctcaactcatcctacaacaag
ttctgggtgccctgcgtctggttctgcaatctggcggctcaggcccggcgcgagggccgc
atccgcgacaacagcgccctcaagctactgctcgaggagctgaatacgttccgggccaag
tgcgggatgctctttcactacgattggattagcatacctcttgtgtacacccaggtggtg
accatcgcagtgtacagctacttcctggcctgcctcatcggtcgccagttcctagaccca
gcgcaaggctacaaaggccacgacnttgacctgtgcgtgcccatcttcactctgctgcag
ttcttcttaaggatgaggccaggctctggcgtgaggagccaagtcttttgggatatgtgg
gggcaaaaggctgggatggaaccaggggaagcagcgtgcctcggtcccagatgtgtcaat
caagggagaggggcgttgccgcagcgcttactcggctgtcggtcccgcagcctggccaaa
gaggacatgcaattccagcgactagacggcgtggacgggccgctgggggagacgcacgga
gacttcctgcagcgcctcctgccggtggctgcgggcacggccggaggcctgctgggccgg
cgcctgtcgatgttgcttcgcaagaacagcggcgtgtcggaggcgtctatagtagccagc
tgcgcgtgcgccaccgcccccgatggcgcggcccaggactgcagctgcgaggacccgctg
ctcgacccaggcctgcgggagcctgagcccgagctccccgccggtcccgagctgcctgtg
cccgcacccgggcctgccgccgaacccttcaccttggtgcccatgcctgggccccgaggg
ccagcgccgccctggctgcccagccccattggcgaggaagaggagaatctggcctga

DBGET integrated database retrieval system