KEGG   Loxodonta africana (African savanna elephant): 100658312
Entry
100658312         CDS       T04351                                 

Gene name
PBX1
Definition
(RefSeq) pre-B-cell leukemia transcription factor 1 isoform X1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100658312 (PBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100658312 (PBX1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658312 (PBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100658312 (PBX1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    100658312 (PBX1)
SSDB
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3 Sec15 LZ3wCH
Other DBs
NCBI-GeneID: 100658312
NCBI-ProteinID: XP_003415258
UniProt: G3TFS0
LinkDB
Position
Unknown
AA seq 430 aa
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggacgagcagcccaggctgatgcattcccatgctggggtcgggatggccggacacccc
ggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaag
caggacattggagacattttacagcaaattatgaccatcacagaccagagtttggatgag
gcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtg
ttgtgtgaaatcaaagaaaaaacagttttgagtatccggggagcgcaggaagaggagcca
acagaccctcagctgatgcggctggacaacatgctgttagcagaaggggtcgcgggcccc
gaaaagggcggtgggtcggcggcagcggcagcagcagcagcggcttctggaggggcaggt
tcagacaactcagtggagcattccgattacagagccaaactctcacagatcagacaaatc
taccacacagagctggagaaatacgagcaggcatgcaacgagttcacgacccacgtgatg
aatctcctgcgagagcaaagccggaccaggcccatctccccgaaggagattgagcggatg
gtcagtatcatccaccgcaagttcagctccatccagatgcagctcaagcagagcacgtgt
gaggctgtcatgatcctgcgttcccggttcctggacgcacggcgaaagagacggaatttc
aataagcaagctaccgaaatcctgaatgagtatttctattcccatctcagcaacccttac
cccagtgaggaagccaaagaggagttagcgaagaagtgtggcatcacagtctcccaggta
tcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagag
gaagccaatatttatgctgccaaaacggctgtcactgctaccaatgtgtcagcccatgga
agccaagctaactcaccctcaactcccaactcagctggttcttccagttcttttaacatg
tcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggg
gcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccag
acaggaggatacagtgacggactcgcagccagtcagatgtacagtccgcagggcatcagt
gctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggc
cctggcagtgttcactctgatacctccaactga

DBGET integrated database retrieval system