KEGG   Loxodonta africana (African savanna elephant): 100658318
Entry
100658318         CDS       T04351                                 

Gene name
PLD2
Definition
(RefSeq) LOW QUALITY PROTEIN: phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04144  Endocytosis
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04912  GnRH signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100658318 (PLD2)
   00565 Ether lipid metabolism
    100658318 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100658318 (PLD2)
   04072 Phospholipase D signaling pathway
    100658318 (PLD2)
   04071 Sphingolipid signaling pathway
    100658318 (PLD2)
   04024 cAMP signaling pathway
    100658318 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100658318 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100658318 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100658318 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    100658318 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100658318 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658318 (PLD2)
   05231 Choline metabolism in cancer
    100658318 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100658318 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658318 (PLD2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100658318 (PLD2)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100658318 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    100658318 (PLD2)
SSDB
Motif
Pfam: PX PLDc PLDc_2 PH PH_2
Other DBs
NCBI-GeneID: 100658318
NCBI-ProteinID: XP_023411913
LinkDB
Position
Unknown
AA seq 977 aa
MVVRGGWHRGQGSSRQATCLRPPHVPRMMATPESLFSTGGDLDPSQLQMEPDEVDTLREG
EDPADRMHPFLAIYDLRPLKMHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTH
GDFTWTTKKKFRHFQELHRDLLRHKVLMSLLPLARFAVAYAPAGEAANREIPSLPRAVPE
GSARHAASKQKYLENYLNRLLAMSFYRNYHAMTEFLEVSQLSFITDLGSKGLEGVIRKRS
GGHRVPGLTCCVRDQVCYRWSKRWLVVKDSFLLYMCLETGVISFVQLFDPGFEVQVGKRS
TETRYGVRIDTSHRSLILKCSSYRQARWWGQEITELAQGPGRDFLQLHQHDSYAPPRPGS
LARWFVNGAGYFAAVADAILRAREEIFITDWWLSPEVYLKRPAHSDDWRLDVMLKRKAVR
RVARLDGMWLMDGGCLEGTVAWEKVGNLRLQGEEMFLSWHSVGKHRFSWPLLPCLMLLHP
NIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDSHYRLTDLGDSSESAAPQ
PPTPCPGSPATPDLSHNQHFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGV
VVHGPPARDLARHFIQRWNFTKTTKAKYKIPMYSYLLPKSSNTANQLPFIFPGAQCATVQ
VLRSVDRWSAGTSENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRI
LKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAM
GTAWRDYMSICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLLGKRDS
ELAVLVEDTEMEPSLMNGVEYQAGSMILGASAQPDLDLRDPVCDDFFQLWQETAENNANI
YEQIFRCLPSNATRSMRALRAYVAVEPLATVSPPLAQSELTKVQGHLVHFPLRFLEDESL
LPSLGSKEGMIPLEVWT
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggtggtccgtgggggctggcatagggggcagggttcttccaggcaggccacctgcctg
aggcctccccatgttcctaggatgatggccaccccagagagcctgttctccactgggggc
gacctggacccaagccagctacagatggagcccgatgaagtggacaccctgagggaggga
gaggacccagctgaccggatgcacccctttctggccatctatgaccttcggcctctgaaa
atgcaccctttggtgttcgcccctggagtccctgtcacagcccaggtggtgggcactgaa
agatacaccagtggatccaaggtgggaacctgcaccctgtattctgtccgcttgactcat
ggcgactttacctggacaacaaagaagaagttccgccatttccaggagctgcaccgggac
ctcctgagacacaaagttctgatgagtctgctccctctggcgcgctttgctgttgcctat
gctccagccggagaggccgccaacagagagattccctctctgccccgagcggttcctgag
ggctccgccagacacgcagccagcaaacagaagtacctagagaattatctcaaccgcctc
ttggccatgtctttctaccgcaactatcacgccatgacagagttcctggaagtcagtcag
ctgtcctttatcacagaccttggctccaaaggactggagggggtgatccgcaagcgctca
gggggccaccgggttcctggcctcacctgctgtgtccgagaccaagtttgttatcgctgg
tccaagaggtggctggtggtgaaggactccttcctgctgtacatgtgcctcgagaccggc
gtcatctcatttgtccagctcttcgaccctggcttcgaggtgcaagtggggaaaaggagc
acagagacacggtatggggtccgcattgacacctcccacaggtccctgattctcaagtgc
agcagctaccggcaggcacggtggtggggccaggaaatcaccgagctggctcagggccca
ggcagagacttcctacagctgcaccagcatgacagctatgctccgccccggcctgggtcc
ctggcccggtggtttgtgaatggggcgggttacttcgcggctgtggcagatgccatcctg
cgagcacgggaggagattttcatcacagactggtggttgagtcctgaggtttacctgaag
cgtccagcccattcagatgactggagactggacgttatgctcaagaggaaggcggtaagg
agggtggcccggctagacggtatgtggcttatggatggaggttgcctagaagggactgta
gcatgggagaaggtagggaatctgaggcttcagggggaggaaatgttcctatcctggcac
agtgttggcaaacatcgcttctcctggccccttcttccctgtctgatgctgctgcacccc
aacataaaggtgatgcgccacccagaccaggtgactttgtgggcccatcatgaaaagctc
ctggtggtggaccaagtagtggccttcttgggggggctggaccttgcctatggccgctgg
gatgactcacactaccgactgactgaccttggggactcctccgaatcagccgcccctcag
cctcccaccccgtgcccaggctctccagctaccccagacctctcccacaaccaacacttc
tggctgggcaaggactacagcaatcttatcaccaaggactgggtgcagctggaccggcct
tttgaggatttcattgacagggagaccacaccccggatgccatggcgggatgttggggtg
gttgtccacggccccccagcccgggacctcgcccggcacttcatccagcgctggaacttc
accaagactaccaaggcaaagtacaagatacccatgtactcctacctgctgcccaagtcc
tccaacactgcaaaccagctccccttcatattccctggggcacagtgtgctactgtgcag
gtcttaaggtcagtggaccgctggtcagcagggacttcggagaactccatcctcaatgcc
tacctgcacaccatcagggagagccagcacttcctctacattgagaatcagttcttcatt
agctgctcagatgggcggacggttctgaacaaggtgggcgatgagattgtggacagaatc
ctgaaggcccacaaacaggggcagtgcttccgagtatatgtgcttttgcccctgctccct
ggctttgagggtgacatctccacaggtggtggtaactccatccaggccattctgcacttc
acttacaggactctgtgtcgtggggagtattcaatcctacatcgcctcaaagcagccatg
gggacagcgtggcgggactacatgtccatctgtgggctccgcacacatggggagctgggt
gggcacccagtctcagaactcatctatatccacagcaaaatgctcattgccgacgaccga
acagtcatcattggctctgcaaacatcaatgaccggagcttactggggaagcgggacagt
gagctggctgtgctggttgaggacacagagatggagccatccctcatgaacggggtggag
tatcaggcaggcagcatgattctcggggccagtgcccagccagacctggatctccgagac
cctgtctgtgatgacttcttccagttgtggcaagagacagctgagaacaatgccaatatc
tatgagcagatcttccgctgcctgccatccaatgccacacgctccatgcgggcactccgg
gcatatgtggctgtggagcctctggccacggtcagccctcccttggcacagtctgagctc
accaaggtccagggccacttggtccacttccccctcaggttcctggaggacgagtctttg
ctgccctcccttggcagcaaggagggcatgatacccctggaggtatggacatag

KEGG   Loxodonta africana (African savanna elephant): 100660595
Entry
100660595         CDS       T04351                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04144  Endocytosis
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04912  GnRH signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100660595 (PLD1)
   00565 Ether lipid metabolism
    100660595 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100660595 (PLD1)
   04072 Phospholipase D signaling pathway
    100660595 (PLD1)
   04071 Sphingolipid signaling pathway
    100660595 (PLD1)
   04024 cAMP signaling pathway
    100660595 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100660595 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100660595 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100660595 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100660595 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100660595 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660595 (PLD1)
   05231 Choline metabolism in cancer
    100660595 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100660595 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660595 (PLD1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100660595 (PLD1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100660595 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100660595 (PLD1)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH DUF3785
Other DBs
NCBI-GeneID: 100660595
NCBI-ProteinID: XP_010594332
LinkDB
Position
Unknown
AA seq 1037 aa
MSLKNEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDFDVSPGDPKTHEVSIPFSA
IYNTQGFKEPNIQTYLSGCPIKVKVLEVERFTSTTRVPSINVYTIELTHGEFKWQVKRKF
KHFEEFHRELLKYKAFIRIPIPTRRHTFRRQNVKGEEPREMPNLPRSSETSIREEQFLGR
RKQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIRDLGPKGIEGMIMKRSGGHRIPGLN
CCGQGRVCYRWSKRWLIVKDSFLLYMKPDNGAIAFVLLVDKEFRIKVGKKETETKYGLRI
DNLSRTLILKCNSYRQARWWGGAIEEFIQKHGADFLKDHRFGSYAAIQENTLAKWYVNAK
GYFEDVANAMEEAEEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIML
YKEVELALGINSEYSKRTLMHLHPNIKVMRHPDHVSSTVYLWAHHEKLVVIDQSVAFVGG
IDLAYGRWDDNEHRLTDVGSVKRVITGSSLVSLTAETAESTESLHLKDKSKSNTNLPILK
SVDDMDSKMKGIGKPGKFSKFSLYRQLHKRHLQSADSISSIDSTCNTGSIRSLQTGVGEL
HGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASVVHGKAARDVARHF
IQRWNFTKIMKSKYRSLSYPFLLPKSQTTAQELKYQVPESVCAKVQLLRSAADWSAGIKY
HEESIHTAYIHVIENSKHYIYIENQFFISCADDRVVFNRIGNAIAQRILKAHRESQRYRV
YVVIPLLPGFEGDISTGGGNALQAVMHFNYRTICRGENSILGQLKAEIGNQWINYISFCG
LRTHAQLEGSLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETV
PSVMDGEEYQAGRFAQGLRLQCFRVVLGYLSDLSEDIQDPVSDKFFKEVWVSIAARNATI
YDKVFRCLPNDEVHNLIQLRDFITKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEESL
LPSVGTKEAMVPMEVWT
NT seq 3114 nt   +upstreamnt  +downstreamnt
atgtcgctgaaaaatgagcccagagtaaacacctctgcactgcagaaaattgctgccgac
atgagcaacctgatagaaaatctagacacgcgggagctccactttgagggagaggaggtg
gattttgatgtgtctcctggtgatcccaagacacatgaagtgtctattcctttctctgct
atttataacacgcaaggatttaaggagcctaatatacagacgtatctctctggctgtcca
ataaaagtgaaagttctggaagtggaacgctttacatctacaacaagggtaccaagtatc
aatgtttacactattgaattaacacatggagaatttaagtggcaagttaagaggaaattc
aagcactttgaagaatttcacagagaattgctcaaatacaaagcctttatccgaatccca
attcccaccagaagacacacattcagaagacaaaatgtcaaaggggaggagcctcgagag
atgccaaatttaccacgttcatctgaaactagtattagagaagaacaattcttaggtaga
aggaaacaactggaagattacttgacgaagctactgaagatgcccatgtatagaaactat
catgcgacaacagaattccttgacataagccagctgtctttcatccgtgatttgggacca
aagggcatagaaggtatgataatgaaaaggtctggaggacataggataccgggcttgaat
tgctgtggccagggaagagtctgctaccgatggtcaaaaaggtggttaatagtgaaagat
tcttttttactgtatatgaagccagacaatggtgctattgccttcgtcctgctggtagat
aaagaattcagaattaaggtggggaagaaggagacagagactaaatatggactccgaatt
gataatctctccaggacacttattttaaaatgcaacagctatagacaggctcgatggtgg
ggaggggctatagaagaattcatccagaagcacggcgctgactttctcaaagatcatcga
tttgggtcatatgctgctatccaagagaacacgctagctaaatggtatgttaacgccaaa
ggatattttgaagatgtggcaaatgcaatggaagaggctgaagaagagatttttatcaca
gattggtggttgagtccagaaatcttcctgaaacgcccggtggttgaaggaaatcgctgg
aggttggactgcattcttaaacgaaaagcacaacaaggggtgaggatcttcatcatgctc
tacaaagaggtggaactcgctcttggaatcaatagtgaatacagcaagaggactttaatg
catctgcaccccaacattaaggtgatgaggcacccagaccatgtgtcatccactgtgtat
ctgtgggctcatcatgagaagctcgtcgtcatcgaccagtcagtggccttcgtgggtggg
attgacctggcttatggaaggtgggacgacaatgagcacagactcacagatgtgggtagc
gtgaagcgtgtcattactggatcatccctggtgtccctcacagctgaaacagcagagtct
acagaatcgttacacctcaaagataaaagcaaatcgaatacaaatctgcccatcttgaag
agtgttgatgatatggattcaaaaatgaaaggcataggaaagccgggaaagttctccaaa
ttcagcctgtacaggcagctccacaagcgtcacctgcaaagtgcagacagcatcagcagc
attgacagcacctgcaatactggctccatccgcagcttacaaacaggcgtcggggagctg
catggggaaaccagattctggcacggaaaagattactgcaacttcgtcttcaaagactgg
gttcagcttgacaaaccttttgcagatttcattgacaggtactccactccccggatgcca
tggcacgacattgcctctgtggtccacgggaaggcggctcgtgacgtggctcgtcatttc
atccagcgctggaacttcacaaagattatgaaatcaaaatatcggtctctttcgtaccca
tttctgcttccaaaatctcagacaacagcccaggagttgaaatatcaagtgcctgaatct
gtatgtgcaaaagtacagttgctccgctctgctgctgattggtctgcgggtataaagtac
catgaagagtccatccacaccgcttacatacatgtgatagagaacagcaagcactatatc
tacatagaaaatcagtttttcataagctgcgctgatgacagagttgttttcaacaggatt
ggtaatgccattgcccagaggatacttaaagcccacagggaaagccagagataccgggtg
tatgttgtgataccgctcctgccagggtttgaaggagacatttcaaccggtggaggaaac
gcgttacaagcagtaatgcatttcaactacagaaccatatgcagaggagaaaattccatc
cttggacagttaaaagcagagattggcaatcagtggataaattacatctcattctgtggc
cttagaacacatgcacagcttgaaggaagcctagtcactgagcttatctatgtccacagc
aagctgctgattgccgatgacaacacggttattattggctctgctaatataaatgatcga
agcatgctgggaaagcgtgacagtgaaatggctgtcattgtacaggacacggagacggtt
ccttctgtaatggacggagaagagtaccaagctggccggtttgcccaaggacttcggctg
cagtgctttagggttgtccttggctatctttctgatttgagtgaggacattcaggaccca
gtgagtgacaaattcttcaaggaggtttgggtttcaatagcagctcgaaatgctacaatt
tacgataaggtgttccggtgccttcccaatgatgaagtacacaatttaattcaactgcga
gactttataaccaaacccatattagcaaaagaagatcccattagagctgaggaagaactg
aaaaagattcgtgggttcttggtgcaattccccttttacttcttgtctgaagaaagccta
ctgccttctgttggaaccaaagaagccatggtgcctatggaggtttggacttaa

DBGET integrated database retrieval system