KEGG   Loxodonta africana (African savanna elephant): 100658388
Entry
100658388         CDS       T04351                                 

Gene name
GHRL
Definition
(RefSeq) appetite-regulating hormone
  KO
K05254  ghrelin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100658388 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100658388 (GHRL)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100658388 (GHRL)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 100658388
NCBI-ProteinID: XP_023403696
LinkDB
Position
Unknown
AA seq 128 aa
MLSTGTLCSLLLLSVFWVDFAMAGSSFLSPKNQKLQQRKESKKPPAKLQPRAIEGWLHPE
DESQAEGTEDELKIWFNAPFDIGIKLSGAQYQQHGWALGKFLQDILWEEAKGKPLPRSGQ
FSFCGSQM
NT seq 387 nt   +upstreamnt  +downstreamnt
atgctctccacggggaccctctgcagcctgctgctcctcagtgtgttctgggtagacttc
gccatggcaggctccagcttcctgagccccaaaaaccagaagctccagcagagaaaggag
tccaagaagccaccagccaaactgcagccccgagcgatagaaggctggctccacccggaa
gacgaaagtcaggcagaagggacagaggatgagctgaaaatctggttcaacgcccccttt
gacattggaatcaagctgtcaggcgctcagtaccagcagcatggctgggccctggggaag
ttccttcaggacatcctttgggaagaggccaaaggtaagcccttgcctcggtcaggccaa
ttcagtttctgtgggtcccaaatgtga

DBGET integrated database retrieval system