KEGG   Loxodonta africana (African savanna elephant): 100658415
Entry
100658415         CDS       T04351                                 

Gene name
GRIA4
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor 4
  KO
K05200  glutamate receptor 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100658415 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100658415 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100658415 (GRIA4)
   04728 Dopaminergic synapse
    100658415 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100658415 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100658415 (GRIA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100658415 (GRIA4)
   05022 Pathways of neurodegeneration - multiple diseases
    100658415 (GRIA4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100658415 (GRIA4)
   05033 Nicotine addiction
    100658415 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100658415 (GRIA4)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100658415 (GRIA4)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Other DBs
NCBI-GeneID: 100658415
NCBI-ProteinID: XP_023410476
LinkDB
Position
Unknown
AA seq 799 aa
MLIFCVFVFFFFSVCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQ
FVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENF
NDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISL
ERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKVIMEKRQKIDISRR
GNAGDCLXNPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPR
KVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEG
YCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITL
VREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLV
SRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGG
VWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSK
IAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKV
GGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDK
TSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKSAQTFNPTSSQNTQ
NLATYREGYNVYGTESIKI
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgctaatattttgtgtttttgtttttttcttcttttcagtctgttcccagtattctaga
ggagtttttgccatttttggactctatgataagaggtctgtacataccttgacgtcgttc
tgcagcgccttacacatctccctcattacaccaagtttccctactgagggagagagccag
tttgtgctgcagttaagaccttctttaagaggagcactgttgagtctgctggatcattac
gaatggaactgttttgtcttcctgtatgacacagataggggatattcgatacttcaagct
attatggaaaaagcaggacaaaatggttggcacgtcagtgctatatgtgtggaaaacttt
aatgatgtcagctatagacaacttctagaagaacttgatcgaagacaagagaagaaattt
gtaatagactgtgagatagaaaggcttcaaaacatattagaacagattgtaagtgttggg
aagcatgttaaaggctaccattatatcattgcaaacttgggattcaaggatatttcgctt
gagagatttatacatggtggagccaatgttacaggtttccaattagtagattttaacacg
cctatggtaaccaaactaatggatcgctggaagaaactagatcagagagagtatccagga
tctgagactccaccaaaggttataatggaaaaaaggcaaaaaattgatatttcaaggaga
ggaaatgctggggattgtctgngcaatcctgctgctccttggggtcaggggattgacatg
gagaggacactcaagcaggttcgaattcaagggcttacaggaaatgttcagtttgaccac
tatggacgtagagtcaattataccatggatgtgtttgagctgaagagcacagggcctaga
aaggttggctactggaatgatatggataaactggtcttgattcaggatgtacccactctt
ggcaatgacacagcagctattgaaaatagaacagtagttgtaaccacaattatggaatcc
ccatatgttatgtacaagaagaatcatgaaatgttcgaaggaaatgacaagtatgaagga
tactgtgtagatttggcatctgaaattgcaaaacatattggtatcaagtataaaattgcc
attgtccctgatggaaaatatggagcaagagatgcagacacaaaaatctggaatggtatg
gtaggagagcttgtttatgggaaagcagagattgctattgcccctctgacaatcactttg
gttcgagaggaggtcatcgacttctctaagcccttcatgagtctgggcatatctatcatg
atcaaaaagcctcagaaatctaaaccaggagtgttttccttcttggaccctctggcctat
gagatttggatgtgcatagtctttgcctacattggtgtcagcgtggtcttgttcctagtt
agtaggtttagcccatatgagtggcacacagaagagccagaagatggaaaggagggaccg
agcgaccagcctcccaatgagtttggcatctttaacagcctctggttttccctgggtgct
tttatgcagcaaggatgtgacatttcacccagatccctctcaggtcgaattgttggaggt
gtttggtggttctttacactcatcattatatcatcttatactgctaacctcgctgctttc
ctgaccgttgagcgaatggtctcccccatagaaagtgcggaagacctggccaaacagaca
gaaattgcctatggaaccctggattcaggatcaacaaaggaattctttaggagatcaaaa
atagcagtgtatgaaaagatgtggacctacatgcgatcagcagagccatcagtgttcact
aggactacagctgagggagtagctcgtgtccgcaaatccaagggcaaatttgcctttctc
ctggagtccactatgaatgaatacattgagcagcgaaagccatgtgacacgatgaaagtg
ggaggaaatctggattccaaaggctatggagtagcaacgcccaagggttcctcattaaga
actcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtcttagacaagctgaaa
aacaaatggtggtacgataaaggtgaatgtggacccaaggactctggaagcaaggacaag
acgagtgccttgagcctgagcaacgtagcaggcgtcttctacattctggttggcggcttg
ggcttggcaatgctggtggctttgatagagttctgttacaagtccagggcagaagcgaag
agaatgaaggtggcaaagagtgcacagacttttaacccaacttcctcgcagaatacccag
aatttagcaacttatagagaaggttacaacgtatatggaaccgaaagtattaaaatttag

KEGG   Loxodonta africana (African savanna elephant): 100658980
Entry
100658980         CDS       T04351                                 

Gene name
GRIA3
Definition
(RefSeq) glutamate receptor 3 isoform X1
  KO
K05199  glutamate receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100658980 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100658980 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100658980 (GRIA3)
   04728 Dopaminergic synapse
    100658980 (GRIA3)
   04730 Long-term depression
    100658980 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    100658980 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100658980 (GRIA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100658980 (GRIA3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100658980 (GRIA3)
   05017 Spinocerebellar ataxia
    100658980 (GRIA3)
   05022 Pathways of neurodegeneration - multiple diseases
    100658980 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    100658980 (GRIA3)
   05033 Nicotine addiction
    100658980 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100658980 (GRIA3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100658980 (GRIA3)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 NusG_add DUF2061
Other DBs
NCBI-GeneID: 100658980
NCBI-ProteinID: XP_003414810
LinkDB
Position
Unknown
AA seq 894 aa
MARQKKMGQSVLRAFFLVVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNL
AVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaagcgtgctccgggcgttcttcttggtagtccta
gggcttttgggtcattctcacggaggattccctaacaccatcagcataggtggacttttc
atgagaaacacggtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccacggagaagcccttccatttgaattaccacgtagatcacttggattcc
tccaatagtttttctgtgactaacgctttctgctcccagttctcgagaggggtgtatgcc
atctttggattctatgaccagatgtcaatgaacaccctgacctccttctgtggggccctg
cacacgtcctttgtcacacccagcttccccactgacgcagacgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtcttctgggtcactacaagtgggagaag
tttgtgtacctctatgacacagaaagaggattttccatcctccaagcgattatggaagca
gcagtgcaaaacaattggcaagtaacagcaaggtctgtcggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgcgaagttgaaaggattaacacaattttggaacaggtggtgatcctggggaaacattca
agaggttatcactacatgcttgctaacctgggttttactgatattttgctggaaagagtc
atgcatgggggagccaacattacaggatttcagattgtcaacaacgaaaaccctatggtt
cagcagttcatacagcgatgggtgaggctggatgaaagggaattccctgaagccaagaac
gcaccactaaagtatacgtctgcattgacacacgatgcaatcctcgtcatagcagaagcc
ttccgctatctgaggaggcagcgagtggatgtgtcccggagaggcagtgctggtgactgc
ttggcaaatcctgctgttccctggagtcaaggaattgatatcgagagagctctgaaaatg
gtgcaagtacaaggaatgactggaaacatccaatttgacacctacgggcgtaggacaaat
tataccatcgatgtgtacgaaatgaaagtcactggctctcgaaaagctggctactggaat
gagtatgaaaggtttgtgcctttctcagatcagcaaatcagcaacgacagtgcctcctcg
gagaaccgcaccatagtagtgactactattctggaatcaccatatgtgatgtataagaag
aaccatgagcaactggaaggaaatgagcgctacgaaggctattgtgtagacttagcctat
gaaatagccaaacacgtaaggatcaaatacaaactgtccattgtcggtgacgggaaatat
ggtgcaagggatccagagactaaaatatggaacggcatggttggggaacttgtctacggg
agagctgatatagctgttgccccactcactataacactggtccgggaagaagtcatagat
ttttcaaagccgtttatgagcctgggcatctccatcatgataaagaagcctcagaagtca
aaaccaggcgtattttcatttctggatcccttggcttatgagatctggatgtgtatcgtc
ttcgcttacatcggagtcagtgtagttctgttcctagtcagcagattcagcccttatgaa
tggcacttggaagacaacaatgaagaaccccgtgatccacagagccctcctgatcctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaagga
tgtgatatttctccaagatcactctccgggcgcattgttggaggggtttggtggttcttc
accctgatcataatttcttcctatactgccaatctcgctgcttttctgaccgtggagagg
atggtttctcccatagagagcgctgaagacttagccaagcagactgaaattgcatatggg
accctggactccgggtcaacaaaagaatttttcagaaggtccaaaattgctgtctatgag
aaaatgtggtcttacatgaaatctgcagagccatctgtgtttaccaaaacaacggcagat
ggagtggcccgtgtgcgaaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccgtgtgatacgatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaagaacgcctgtaaacctt
gcagtattgaaactcagtgaacaaggcatcttagacaagctgaaaaacaaatggtggtac
gataagggggaatgtggagccaaggactccgggagtaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggagttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaaacctgctcctgccaccaacactcagaattacgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaaaatctag

KEGG   Loxodonta africana (African savanna elephant): 100676565
Entry
100676565         CDS       T04351                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X2
  KO
K05197  glutamate receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100676565 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676565 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100676565 (GRIA1)
   04728 Dopaminergic synapse
    100676565 (GRIA1)
   04720 Long-term potentiation
    100676565 (GRIA1)
   04730 Long-term depression
    100676565 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    100676565 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100676565 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100676565 (GRIA1)
   05016 Huntington disease
    100676565 (GRIA1)
   05017 Spinocerebellar ataxia
    100676565 (GRIA1)
   05022 Pathways of neurodegeneration - multiple diseases
    100676565 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100676565 (GRIA1)
   05033 Nicotine addiction
    100676565 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100676565 (GRIA1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100676565 (GRIA1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 100676565
NCBI-ProteinID: XP_003404663
LinkDB
Position
Unknown
AA seq 906 aa
MQHIFAFFCTGFLGTVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQRRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGSGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcacggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcgcaactcacagagcccccaaagctgcttccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttctcagttctccaaa
ggagtctacgccatctttgggttttatgaacggaggactgtcaacatgctaacctccttc
tgcggggctctccacgtctgcttcattaccccgagctttcctgtcgatacatccaatcaa
tttgtccttcagcggcgccctgagctgcaggatgccctcattagcatcatcgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccgtggcttgtccgtcctgcagaaa
gtcctcgacacagctgctgagaagaactggcaggtgacggcagtcaacattttaacaacc
acagaggagggataccggatgctctttcaggacctggagaagaaaaaggagaggctggtg
gtggtggactgtgaatcagagcgcctcaatgccatcctaggccagattataaagctagag
aagaatggcatcggctaccactacatccttgcaaatctgggcttcatggacattgaccta
aacaagttcaaggagagtggagctaacgtaacaggtttccagttggtgaactatacagac
acaatcccagccaagatcatgcagcagtggaagaacagcgatgctcgagaccacacccga
gtggactggaagagacctaagtacacctccgcgctcacttacgatggagtgaaggtgatg
gcggaggctttccagagtctgcggcggcagcggattgatatatctcgccgggggaatgcc
ggggactgtctggctaacccagccgtaccctggggacagggcatcgacatccagagagct
ctgcagcaggtgcgatttgaaggcttgacaggaaacgtgcagtttaatgagaagggacgc
cggaccaactacactctccatgtgattgaaatgaaacatgatggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgctcaagcagggggagat
aattcaagtgttcagaatagaacgtacatcgtcactacaatcctcgaagacccttacgtg
atgctcaagaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctggcagcggagattgccaagcacgtgggctactcctaccgtcttgagattgtcagc
gatggaaaatatggagcccgagaccctgacaccaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggcccccttaaccatcaccttggtccgagaa
gaggtcatagacttctccaagccatttatgagtttggggatctccatcatgataaaaaaa
ccacagaagtccaagccgggggtcttctccttcctcgatcctttggcttatgagatttgg
atgtgcatcgtttttgcctacattggagtgagtgttgtcctcttcctggtcagccgcttc
agcccctacgaatggcacagtgaagagtttgaggaaggacgtgaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagcttgtggttctctctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctatctggccgcatcgttggtggtgtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggccgccttcctgacggtg
gagaggatggtgtctcccattgagagtgcagaggacctagcaaagcagacggaaatcgct
tatgggacactggaagcaggatccactaaggagttcttcaggagatctaaaattgccgtg
tttgagaagatgtggacatacatgaagtcagcagaaccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaagggcaagtatgcctacctcctggaatcc
accatgaacgagtatattgagcagcggaagccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtccgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagcgct
ctgagcctcagcaatgtggcgggagtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagaggatgaag
ggtttctgtttgatcccacagcaatccatcaacgaagccatacggacatcgactcttccc
cggaacagcggggcaggagccagcggcagcggcagtggagaaaatggtcgggtggtcagc
cacgacttccctaagtccatgcaatcgatcccctgcatgagccacagttcagggatgccc
ttgggagccacaggattgtaa

KEGG   Loxodonta africana (African savanna elephant): 104846717
Entry
104846717         CDS       T04351                                 

Gene name
GRIA2
Definition
(RefSeq) glutamate receptor 2
  KO
K05198  glutamate receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104846717 (GRIA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104846717 (GRIA2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    104846717 (GRIA2)
   04728 Dopaminergic synapse
    104846717 (GRIA2)
   04720 Long-term potentiation
    104846717 (GRIA2)
   04730 Long-term depression
    104846717 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    104846717 (GRIA2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104846717 (GRIA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104846717 (GRIA2)
   05016 Huntington disease
    104846717 (GRIA2)
   05017 Spinocerebellar ataxia
    104846717 (GRIA2)
   05022 Pathways of neurodegeneration - multiple diseases
    104846717 (GRIA2)
  09165 Substance dependence
   05030 Cocaine addiction
    104846717 (GRIA2)
   05031 Amphetamine addiction
    104846717 (GRIA2)
   05033 Nicotine addiction
    104846717 (GRIA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    104846717 (GRIA2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   104846717 (GRIA2)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor DUF2061
Other DBs
NCBI-GeneID: 104846717
NCBI-ProteinID: XP_010596469
LinkDB
Position
Unknown
AA seq 945 aa
MKRKDKKRGLREKRDSQERKAIVVKLHSFEELDGLSGIVILMKSCKACACCRAKAKCFQM
AMVTRESLDSSLQSLKQMENERLKWFRANLESLSTLQAVLDSAAEKKWQVTAINVGNINN
DKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQGFTDGDLLKIQFGGANVSGFQIV
DYDDSLVSKFIERWSTLEEKEYPGAHTTTIKDLVSARSLVGKDGECVEKGYYEGINSKLR
ETEVEQKILDSLLSESLSERVIFKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDC
LANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWS
EVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHELLEGNERYEGYCVDLA
AEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPY
EWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
LIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDK
MWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKVSPSEKSD
GTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGG
LGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNMTLSDAMRS
KARLSITGSTGENGRVIAPEFPIAVHAVPYVSPGMGMNVSVTGLS
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgaagagaaaggataagaagagagggttgagagagaaaagggatagtcaggagagaaaa
gccattgttgtaaaattacattcatttgaagaattagatggattgtctggaattgtaatt
cttatgaagtcttgtaaagcttgtgcctgctgtcgggccaaagccaagtgtttccagatg
gccatggtaactagggagtcccttgacagctcactccagagtctaaaacaaatggaaaat
gaaaggttgaagtggtttagagcaaatttagaaagcttatcgacactgcaagctgtgctg
gattccgctgctgagaagaaatggcaagtgactgctatcaatgtgggaaacattaacaat
gacaagaaagatgagacctaccgatcactgtttcaagatctggaattaaaaaaagaacgg
cgtgtaatcctggactgtgaacgggataaagtgaacgacattgtagaccagggttttact
gatggagacttattaaaaattcagtttggaggtgcaaatgtctctggatttcagatagtg
gactatgatgattccctggtatctaaatttatagaaagatggtcaacactggaagaaaaa
gagtaccctggagcacacacgacgacaattaaggatctggtgtcagcccgcagtctagtg
gggaaagacggtgagtgtgtggagaaaggatactatgaaggaataaacagcaaactccgg
gagacggaggtggagcagaagattttagatagtttgctctcggagagcctctctgaaagg
gtgatttttaagtatacttctgccctgacctacgatgctgtgcaagtgatgactgaagct
ttccgcaacctcaggaagcagaggattgaaatctcccgaagagggaatgctggagactgt
ctggcaaacccagcagtcccctggggacagggcgtagaaatagaaagggctctcaagcag
gttcaggttgaaggtctctcaggaaatataaagtttgaccagaatggaaaacgaataaac
tatacaattaacatcatggagctcaaaacaaacgggccccggaagattggatactggagt
gaagtggacaaaatggttgttacccttaccgagctcccgtctggaaatgatacgtctggg
cttgagaataagactgttgttgtcaccacgattttggaatctccatatgttatgatgaaa
aaaaatcacgaactccttgaaggcaatgagcgctatgaagggtactgtgttgacttggct
gcagaaattgccaaacactgtgggttcaagtacaagctgacaatcgttggggatggcaag
tatggggccagggatgcagacacaaaaatttggaatgggatggttggagaacttgtctat
gggaaagctgatattgcaattgcaccattaactatcacccttgtgagagaagaggtgatt
gacttctcaaagccctttatgagcctcgggatatctataatgatcaagaagcctcagaag
tccaagccaggagtgttttcatttctcgatcctttagcctatgagatctggatgtgcatt
gtttttgcctacattggggtcagtgtggttttattcctggtcagcagatttagcccctac
gagtggcacactgaagagtttgaagatggaagagaaacacaaagtagtgaatcaactaat
gaatttgggatttttaatagtctctggttttccttgggtgcctttatgcagcaaggatgc
gatatttcgccaagatccctctctgggcgcattgttggaggtgtgtggtggttctttacc
ctgatcataatctcatcctacacggctaacttagctgccttcctgactgtagagaggatg
gtgtctcccattgaaagtgctgaagatctttctaagcaaacagaaattgcttatgggaca
ttagactccggctccactaaagagttttttaggagatctaaaattgcagtgtttgataaa
atgtggacctacatgagaagcgcagagccctctgtgtttgtgaggactacagccgaaggg
gtagctagagtacggaagtccaaaggaaaatacgcctacttgctggagtctacgatgaac
gagtacatcgagcaaaggaagccttgcgacaccatgaaagttggtggaaacctggattcc
aaaggctatggcatcgcaacacctaaaggatcctcattaagaaatgcggttaacctcgca
gtactaaaactgaatgaacaaggcctgttggacaaattgaaaaacaaatggtggtacgac
aaaggagagtgcggcagcgggggaggtgattccaaggtcagccccagtgagaaaagtgat
ggaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtcttagacaagctg
aaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctggaagtaaggaa
aagaccagtgccctcagtctgagcaacgttgctggagtattctacatccttgtcgggggc
cttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagggctgaggcg
aaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcgcagaattca
cagaattttgcaacttataaggaaggttacaacatgaccttgagcgatgccatgaggagc
aaggcgagactgtcaattacaggaagtactggagaaaatggacgtgttatagctccagaa
tttccaatagcagtgcatgctgtcccctacgtgagtcctggcatgggaatgaatgtcagt
gtgactggtctctcgtga

DBGET integrated database retrieval system