KEGG   Loxodonta africana (African savanna elephant): 100658431
Entry
100658431         CDS       T04351                                 

Gene name
SPDYC
Definition
(RefSeq) speedy protein C
  KO
K08694  speedy
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100658431 (SPDYC)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100658431 (SPDYC)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100658431
NCBI-ProteinID: XP_023415372
LinkDB
Position
Unknown
AA seq 222 aa
MVLVYFQRASLQLSEYTHSNLFLALYLANDMEEDLEDPKCEIFPWALGEDWRPWVADFLH
QRDKLWARMGFRAAVSRQCCEEVMAKEPSHWAWTRERRPHHGGAQRGCPEAPVSLPRGPG
LSPPHCSLCGLPPCHRRPTPPLPVSFKCSSPTPVWHHPSSHTCLSVAEDPWDGGFIIVLP
PQLHLEPGTYALHSKREQGLWAGGKNGEWQDGRRGTWAPLAV
NT seq 669 nt   +upstreamnt  +downstreamnt
atggtgctggtttacttccagcgtgccagcctgcagctcagcgaatacacccacagcaac
ctgttcttggcactgtaccttgcaaatgacatggaagaggacctggaggaccccaagtgt
gagattttcccatgggcacttggtgaagattggcgtccttgggtggcagacttcttgcac
cagagggacaagctgtgggcccggatgggcttccgggctgccgtgagccgtcagtgctgc
gaggaggtcatggcaaaggagccatcccactgggcctggacacgggagcggcgcccccac
catgggggcgctcagaggggctgcccagaggccccggtctccctgccccggggccctggg
ctctcaccaccccattgctccctttgtggtttgcctccgtgccaccgccgccccacgccc
cccttgcctgtctcattcaagtgctcctctccaacccctgtgtggcatcacccttcctcc
cacacttgtctctcagtggccgaagacccctgggatgggggcttcatcattgtcctgccc
cctcagctgcacctggagccaggcacctatgccctccatagtaagcgggaacaggggctg
tgggccgggggcaagaatggggaatggcaggacgggaggaggggcacatgggccccccta
gctgtgtga

KEGG   Loxodonta africana (African savanna elephant): 100660485
Entry
100660485         CDS       T04351                                 

Gene name
SPDYA
Definition
(RefSeq) speedy protein A
  KO
K08694  speedy
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100660485 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100660485 (SPDYA)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100660485
NCBI-ProteinID: XP_003412001
UniProt: G3TLJ3
LinkDB
Position
Unknown
AA seq 313 aa
MRHNQMCCETPPTVTVHVKSGSNRSHQPKKTINLKRPIFKDSWQASEKNAQSNSKSKRPK
GPCLVIQRQEMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTR
INFFIALYLANTVEEDEEESKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKGRYVRL
GLSSSSSSSIGIAEVMQKHSQESHNSFSMNKAVDPSQADSYFQVANDHQSNKEKKTNFME
KDKSMEWFTGSEE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaggcacaatcagatgtgttgtgagacaccacctactgtcactgttcatgtaaaatca
gggtcaaatagatcacatcagcctaaaaaaaccattaatctgaagcgtcctatttttaaa
gatagttggcaagcatctgaaaaaaatgcacaaagtaacagcaaatctaaacgccccaaa
ggaccttgtctagttatacagcgtcaggaaatgacagctttctttaaattatttgatgat
gatttaattcaagatttcttatggatggactgctgctgtaaaattgcagacaagtatctt
ctggctatgacctttgtttatttcaagagggctaaatttactataaatgagcacaccagg
ataaatttctttattgctctgtatctggcaaatacagttgaagaagatgaagaagaatcg
aagtatgaaatttttccatgggctttaggaaaaaactggagaaaattgttccctaatttc
ttaaagttaagggaccaactctgggatagaattgactatagggctattgtaagcaggcga
tgctgtgaggaggttatggccattgcaccaacccactatatatggcagcgggaacgctct
gtgcatcacagtggagctgtgagaaactacaacagagatgaagttcaactgccccgggga
cctagtgccacaccagtagattgttcactctgtggcaaaaaaggaagatatgttagacta
ggattgtcttcatcgtcatcttcgtccattggtatagcagaagtgatgcaaaaacattct
caggaatcacacaactcgttctcaatgaacaaagcagttgatccttctcaagctgatagc
tattttcaagtagccaatgatcatcaatcaaacaaagaaaagaaaactaacttcatggag
aaagacaaatctatggagtggtttacaggaagtgaagaatga

KEGG   Loxodonta africana (African savanna elephant): 100662224
Entry
100662224         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: speedy protein E4-like
  KO
K08694  speedy
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100662224
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100662224
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100662224
NCBI-ProteinID: XP_010594668
LinkDB
Position
Unknown
AA seq 228 aa
MDSCQPSSQLEDLSPQLSSSGYPLEVIVNEEIPGPSVPWVEPNPLLQSSGRKRDWSTAFE
EEITPAAEDIWVVESLCGLKMKLKRQRVSSVLPEHHEVFNRLLEDPVIKKFLAWDKNLRV
SDKYLLSMVIAYFSRAGLFSWQYRRIHFFLALYLANDMEEDNQAPKQAIFSFLYGKXTRS
QRPLFHKLRFQFVRSMGWKTRVSREECEEIQAYDPEHWVWGRDRTLIP
NT seq 687 nt   +upstreamnt  +downstreamnt
atggacagctgtcaaccaagttctcagttggaggacctgagtccccagctgagctcctca
gggtaccccctggaagtgatagtgaatgaagaaatcccaggaccatcagtcccctgggta
gagcccaaccccctgcttcagtcttctggccggaagagggattggtcaacagcattcgag
gaggagataactccagcagctgaggatatctgggtcgtggagtctctttgcggcctcaag
atgaagctgaagaggcagcgggtgtcatctgtgctaccggagcatcatgaagtcttcaac
aggctgcttgaggatcctgtcattaaaaaattcctggcctgggacaaaaacctgagggtc
tctgacaagtatctcctgagcatggtcattgcttactttagtcgggctggcctcttctcc
tggcagtaccggcggattcacttcttcctagctctttacctagccaatgacatggaagag
gacaaccaggcccccaaacaagccatcttttcgttcctctatgggaagnnaacccgctcc
cagcgcccgttgttccacaagctaagatttcaattcgtcaggtccatgggctggaagacc
agggtttcccgggaagagtgtgaagagatccaggcttatgacccagagcactgggtgtgg
gggcgagaccgcaccctcattccctag

KEGG   Loxodonta africana (African savanna elephant): 100667931
Entry
100667931         CDS       T04351                                 

Definition
(RefSeq) speedy protein E4A-like
  KO
K08694  speedy
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100667931
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100667931
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100667931
NCBI-ProteinID: XP_010592653
LinkDB
Position
Unknown
AA seq 155 aa
MEDVSGLPMQGKRQWESAVEPEHHEVFNRLLEDPVIQRFLAWDKKLRVSDKYLLSMVIAY
FSRAGLFSWQYRRIHFFLALYLASDMEEDNQAPKQAIFFFLYGKSHFQRPMFHKLRFQFI
RSMRWKIWVSREECEEIQAYDPEHWVWGRDRTLIP
NT seq 468 nt   +upstreamnt  +downstreamnt
atggaggacgtaagtggcctcccaatgcaggggaagagacagtgggagtcagctgtggag
ccggagcaccatgaggtcttcaacaggctgcttgaggatcctgtcattcaaagattcttg
gcttgggacaaaaaactgagggtgtccgacaagtatctcctgtccatggtaattgcttat
tttagccgggctggtctcttctcctggcagtaccgacgaattcatttcttcttagctctc
tacctggccagtgatatggaggaagacaaccaggcccctaagcaagccatatttttcttt
ctgtatgggaagagtcacttccagcgccccatgttccacaagctacgatttcaattcatc
cgttccatgcgctggaagatttgggtttctcgggaggaatgtgaagagattcaggcttat
gatccagagcactgggtgtgggggcgagatcgcaccctcattccctag

DBGET integrated database retrieval system