KEGG   Loxodonta africana (African savanna elephant): 100658490
Entry
100658490         CDS       T04351                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100658490 (PLA2G4A)
   00565 Ether lipid metabolism
    100658490 (PLA2G4A)
   00590 Arachidonic acid metabolism
    100658490 (PLA2G4A)
   00591 Linoleic acid metabolism
    100658490 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    100658490 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100658490 (PLA2G4A)
   04014 Ras signaling pathway
    100658490 (PLA2G4A)
   04370 VEGF signaling pathway
    100658490 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    100658490 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100658490 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658490 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    100658490 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    100658490 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100658490 (PLA2G4A)
   04913 Ovarian steroidogenesis
    100658490 (PLA2G4A)
   04921 Oxytocin signaling pathway
    100658490 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100658490 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    100658490 (PLA2G4A)
   04726 Serotonergic synapse
    100658490 (PLA2G4A)
   04730 Long-term depression
    100658490 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100658490 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100658490 (PLA2G4A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100658490 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 100658490
NCBI-ProteinID: XP_010589241
LinkDB
Position
Unknown
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFICTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSAPDLRFSMALCDQEKTFRQQRKEKIKENMKKLLGPENSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSD
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKIKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSASQSKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEDAERDYQNDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRGFTTQESLDEDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKSPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKKAIIESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKTTA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccagtattcccacaagttc
actgtcgtggtgttacgtgccaccaaagtgacaaagggggccttcggtgacatgcttgat
actccagatccgtatgtggaacttttcatctgtaccactcctgacagcaggaaaagaaca
agacacttcaataatgacataaatcccgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagatcacattaatggatgccaattatgttatggatgaa
actctagggacagcaacatttcctatatcttctatgaaagtgggagagaagaaggaagtt
ccctttattttcaaccaagtcactgaaatgattctggaaatgtctcttgaagtttgctca
gccccagaccttcgatttagcatggctctctgtgatcaggagaaaactttcagacaacaa
agaaaagaaaaaataaaggagaacatgaagaaactcttgggtccagagaatagtgaaggc
ttgtattctacccgtgatgtgcctgtggtggccatattgggctcaggtgggggcttccga
gccatggtgggcttctccggtgtgatgaaggcactgtatgaatcagggattttggattgc
gccacctacattgctggtctttctggctccacatggtacatgtcaaccttatattctgat
cctgattttccagagaaagggccagaggagattaatgaagagttaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaagattaaacgatatgttgagtctttatgg
aagaagaaaagctctgggcaacctgtcacctttactgatatctttggaatgttaatagga
gaaacactaattcacaatagaatgaacactacgttaagtagtttgaaggaaaaagtcaac
actgcacaatgccctttacctcttttcacctgtctccatgtcaaacccgatgtttcggag
ttgatgtttgcagattgggttgaatttagtccatatgagattggcatggctaaatatggt
acttttatggcccctgacttatttggaagcaaattttttatgggaacagttgtgaagaaa
tatgaagaaaatcccttgcattttttaatgggtgtctggggaagtgctttttctatatta
ttcaacagagtcttgggtgtttctgcttcacaaagtaaaggttccacaatggaggaagaa
ttagaaaatattacagcgaaacatattgtgagtaatgatagctcggatagtgatgatgaa
tcacaagagcccaaaggcactgaaaatgaagatgccgaaagggactatcaaaatgataat
caagcaagttgggttcatcgaatgttaatggccttggtgagtgattcagctttattcaat
acccgagaaggacgtgctgggaaggtgcacaacttcatgttgggcttgaatctcaataca
tcctatccactgtctcctttgagaggctttaccacacaggagtccttggatgaagatgaa
ttggatgcagctgtggcagatcctgatgaatttgaaagaatatatgagcccctggatgtc
aaaagtaaaaagatccatgtagtggacagtgggctcacatttaacctgccctatcctttg
atcctgagaccacagagaggggtagatctcatcatttcctttgacttttctgcaagacca
agtgactccagtcctcccttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccttttccaaagattgatccttatgtgtttgatcgggaaggactgaaggagtgc
tatgtctttaaacccaagaaccctgatgtggagaaagattgcccaactatcattcacttt
gttctggccaacatcaacttcagaaagtacaagtctccaggtgttccaagagaaactaag
gaagagaaagaaatagctgactttgacatttttgatgatccagaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaaaaggctgcatgatctaatgcacttcaat
accctgaacaacattgatgtgataaagaaagccataattgaaagcatcgaatatagaaga
cagaatccatctcgttgctctgtttctctcagtaatgttgaggcaagacgattcttcaac
aaagagtttctaagcaaaaccacagcatag

KEGG   Loxodonta africana (African savanna elephant): 100667057
Entry
100667057         CDS       T04351                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100667057 (PLA2G4E)
   00565 Ether lipid metabolism
    100667057 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100667057 (PLA2G4E)
   00591 Linoleic acid metabolism
    100667057 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100667057 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100667057 (PLA2G4E)
   04014 Ras signaling pathway
    100667057 (PLA2G4E)
   04370 VEGF signaling pathway
    100667057 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100667057 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100667057 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100667057 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100667057 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100667057 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100667057 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100667057 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100667057 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100667057 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100667057 (PLA2G4E)
   04726 Serotonergic synapse
    100667057 (PLA2G4E)
   04730 Long-term depression
    100667057 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100667057 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100667057 (PLA2G4E)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100667057 (PLA2G4E)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 100667057
NCBI-ProteinID: XP_023414478
LinkDB
Position
Unknown
AA seq 834 aa
MLQRKMPAWVSHDLPDPCTAKDSRPSTTCAPEEGLSPCHLLTVRVIRMKNVRQADVLSQT
DCFVTLWLPTASCEKLRTKTISNCSNPEWNETFNFQIQSQVKNILELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNPEGMEELEVEFLLEESPSAPETLITNGVLVSRQISH
LEVHAEARRQRKSRKKEGLLVTVHESFEHTQHLLPCLEPCHPDPACFHYPKYFQPRICVE
VPKSHWSCGLCCCRARKSSPVCQPLDCLPDGHIMTLPVGENCELHMKSTDCPDVLDVRLG
YSLCPAELEFLEKRKVVVARALKQVLQLEEDLQADEVPLIAIMATGGGTRSMTSMYGHLL
GLQKLNILNCAAYIAGLSGATWTMATLYQDPEWSSKNLEPAVFEARRHVVKDKLPALFPD
QLLKYKEELRQRSQEGYRVTFNDFWGLLIEACLGDKRNECKLSEQRAALCRGQNPLPIYL
TINVKDDVSNQDFREWCEFSPYEVGLQKYGAFVPTELFGSEFFMGRLTKRIPESQMCYML
GLWSSIFSLNLLDAWNLSHTSEEFFHRWTRERVHDIEDEPLLPEIPKCDANALETTVVIP
GSWLSNTFRDILTHRSFVSEFHNFLRGLQLHTDYLQNGQFSKWKDTVLDGFPNQLTESVN
HLCLLDTAFFVNSCYPPLLRPERKADLIIHLNYCAGSQTKPMKQTCEYCTVQNIPFPRYE
LQEDDDHLKECYLMENPQDPEAPIVAFFPLINGTFQKYKAPGVERSPEELEHGQVDIYGP
KTPYATKELTYTEAAFDKLVKLSEYNILNNSDKLLQALRLAVEKKKRLKGQCPS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgctccagaggaagatgcccgcctgggtctcccacgacctgccagacccatgcacagca
aaagacagcagaccctcaaccacctgtgccccagaggagggactgtctccatgccacctg
ctgacagtgagggtcatccggatgaaaaatgtccgtcaggctgacgtgttgagccagaca
gactgctttgtgaccctctggctgcccacagcctcttgtgaaaagctgaggactaagacg
atctccaactgctcaaacccagagtggaatgaaaccttcaacttccagatccagagccaa
gtgaagaacattttagagctgagcgtctgtgatgaagacacagtgacgccagacgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaaa
ttcccacttaaccctgagggcatggaggagctggaggtagagttcctgctggaggagagt
ccctctgcacctgagaccctcatcaccaacggtgtcctggtgtcccggcaaatctcccat
ttggaggtacacgcagaagccaggcgtcagaggaagagcaggaaaaaggagggcctcttg
gtgacggtgcacgagtcctttgaacacacccagcacctcttgccctgcctggagccctgc
cacccagaccctgcctgcttccactaccccaagtacttccagccccggatatgtgtggag
gtgcccaagagccactggagctgtgggctttgctgctgcagagcccgcaagagcagccct
gtctgccagcccctggactgccttcccgatggccatatcatgaccctgcctgtgggtgag
aactgtgaattacacatgaagtctacagactgccccgacgtgctggacgtgcggctgggc
tacagcctgtgcccggcagagctggagttcctggagaagcggaaggtggtggtagctcgg
gcgctgaagcaggtgctgcagctggaggaggacctgcaggcagatgaggtaccgctgata
gccatcatggccaccgggggagggacaagatccatgacctccatgtacggccacctgctg
gggctgcagaagctgaacatcctgaactgtgccgcctatatcgccggcctgtcaggggcc
acctggaccatggctaccttgtaccaagaccccgaatggtcctccaaaaacctggagcct
gctgtcttcgaggcccggaggcatgtagtcaaggacaagctaccagctctgttcccagac
cagctccttaaatacaaggaggaactccggcagcgtagccaggaaggctacagggtcacc
tttaatgacttctggggcctgctgatcgaggcctgtctgggagacaagagaaacgaatgc
aaactgtcagagcagcgagccgctctgtgccgaggccagaaccccctgcccatctacctc
accatcaatgtcaaggatgatgtaagcaaccaagacttcagagagtggtgtgagttctcc
ccctacgaggtgggcctgcagaagtacggggccttcgtccccaccgagctcttcggctcc
gagttcttcatggggcggctgacgaagaggatccctgagtcgcaaatgtgctacatgcta
ggtttgtggagcagcatcttctccctgaacctgctggatgcctggaacctgtcccatacc
tcggaggagtttttccacaggtggacgagagagagagtgcatgatattgaagacgagccg
ctcctgcctgaaatccccaaatgtgacgccaacgccctggagaccacggtggtgatccca
gggtcatggctgtccaacactttccgcgacatcctcacccatcggtcctttgtgtctgag
ttccacaacttcctgagggggctgcagctgcacaccgactacctccagaacggccagttc
tccaagtggaaagacacagttctcgacggcttcccaaaccagctgacggagtccgtgaac
cacttgtgcctgctggacactgcgttctttgtcaactcctgctacccaccccttctacgg
ccagagaggaaagctgacctcatcatccacctcaattactgtgccgggtcccagaccaag
cccatgaagcaaacctgtgagtactgcaccgtgcagaacatccccttccccagatatgag
ctgcaagaagacgacgaccatctcaaggaatgctacctgatggagaacccccaggacccc
gaagcccccattgtggctttcttcccgctcatcaatggcaccttccaaaagtacaaggcc
ccaggtgtggagcgaagccctgaagagctggagcatggccaggttgacatttatggtccc
aaaactccctacgccaccaaggagctgacatacacagaagccgcctttgacaagctggtg
aagctgtctgagtacaacatcctgaacaacagcgacaagctccttcaggccctgcgactg
gcggtggagaagaagaaacgcctgaagggccagtgtccctcctga

KEGG   Loxodonta africana (African savanna elephant): 100675131
Entry
100675131         CDS       T04351                                 

Gene name
PLA2G4D
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100675131 (PLA2G4D)
   00565 Ether lipid metabolism
    100675131 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100675131 (PLA2G4D)
   00591 Linoleic acid metabolism
    100675131 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100675131 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675131 (PLA2G4D)
   04014 Ras signaling pathway
    100675131 (PLA2G4D)
   04370 VEGF signaling pathway
    100675131 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100675131 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100675131 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675131 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100675131 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100675131 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675131 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100675131 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100675131 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675131 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100675131 (PLA2G4D)
   04726 Serotonergic synapse
    100675131 (PLA2G4D)
   04730 Long-term depression
    100675131 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675131 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100675131 (PLA2G4D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100675131 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100675131
NCBI-ProteinID: XP_003418804
LinkDB
Position
Unknown
AA seq 824 aa
MGQQTSSQLGAKTQEREDAGNQGRRETSPCWRLTVKVLEARNLPWADLLSEADPYVILQL
PTVPGTKFKTKTVTNSNNPVWNETFTFRIQSQVKNVLELSIYDEDSIKKDDLFFKFLYDV
SEVLPGRLLQKTFSWDPQVELDVEFLVEKTLDHPENLTTNNVLVARELSCLNVHLDSTGS
MAVAPDQDKLELELVLKGSYEDTQTVTLGKASAFCFHYMAAQETELSGRLRGSTSSGWNT
DISAEPLTVPLQSLTVGKKVTIDLPVPNASEVRLQLKAEGCPEELAVQLGFDLCAEEQAF
LSKRKQVVARALQQALQLEGNLQEDEVPIVGIMATGGGARAMTSLYGHLLALQKLGLLDC
VTYLSGISGSTWTMAHLYGNPEWSQQDLEGPILYAREHMAKSKLETFSPECLSSYLEELK
LRSEQGYPTTFVDLWALVLENMLHGQKMHQTLSGQKAALQQGQNPLPLYLSLNVKENHLE
TLDFKEWVEFSPYEIGFLKYGAFIPSELLGSDFFMGRLMRKLPESRICFLEGIWSNIVSL
NLLDLWHGLTSSGEAWKQHIRDKMRSMEEPPASSETSSYLEASWLQPGTALAQAFKDFLI
NRPLYQCSPNFLHGXQLHQDYYHQKDFSTWADCQLDGTPSQLTLQETQLCLVDSGYFINT
SCPSMFRPGRKLDLILFFDYSLSSSFEVLQQTELYCRAHGLPFPRVELNPQELRQTGECY
LFSDPDRPEAPVLLYFPLVNASFKDHSAPGVQRSSAELQTGQVDLTRATSPYSTFNMTYK
EEDFDRLLHLSDYNVRNSQDTILQALRMALKHHASANRPPEVQT
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgggacaacagacctcttcccagctcggcgccaagacacaggagagggaagatgcaggc
aaccaggggagaagggagacctctccctgctggcggctcacagtgaaggtcctggaggca
cggaacctgccctgggctgacctgttgagcgaggctgatccgtatgtgatccttcagctg
ccaactgtacccggaacaaagtttaagaccaagacggtcaccaactccaacaaccctgta
tggaatgagaccttcaccttccgaatccagagtcaggtcaagaatgttctggagctgagc
atctacgatgaagactctattaaaaaggatgatctcttcttcaagtttctctatgatgtc
tcagaagttctccctggcaggctgctccagaagaccttctcctgggatcctcaggtggag
ctggacgttgagttcctggtggagaaaacgttggaccacccagaaaacctcaccaccaac
aacgtccttgtggcccgggagctgtcgtgcctgaacgtgcatctggacagcacagggagc
atggccgtggccccagatcaggacaaactggagctggagctggtgctgaaggggtcatac
gaggatacacagacagtgaccctgggcaaagcctctgccttctgcttccactacatggca
gcccaggagacagagctgagtgggcgcctgcggggctctacaagcagtggctggaacaca
gacatctcagctgagcccctcactgtgcccctgcagtccttgaccgtggggaagaaggtg
accattgatcttcctgtcccaaatgcttcagaagtgaggcttcagctcaaggcagagggc
tgccccgaggagctggctgtgcagctgggcttcgacctgtgtgcagaggagcaagccttc
ctgagcaagaggaagcaggtggtggccagggccctgcagcaggccctgcagctggagggc
aacctgcaggaggatgaggtccccatcgtgggcataatggccaccggagggggtgcccgg
gccatgacctcactctacggccacctgttggccctgcagaagctgggtctcctggactgc
gtgacctacctcagtggcatctcaggctctacatggacaatggcccacctgtacgggaac
cctgagtggtcacagcaggaccttgagggacccatcctatatgcccgagagcacatggcc
aagagcaagctggagaccttctccccagaatgcctgagcagctacctggaggagctgaag
ctgcggtctgagcagggctaccccaccacctttgtggacctgtgggccctagtgttggag
aacatgctgcatggccagaagatgcatcagacgctgtcaggacagaaagctgctctgcag
cagggccagaaccctctgccactctacctgagcctcaatgtcaaagagaaccatctggag
accctcgacttcaaggagtgggtcgagttctccccctatgagattgggttcttgaagtat
ggggccttcatcccctctgagctcttgggctctgacttcttcatggggcggctgatgagg
aagctccctgagtcccggatctgctttcttgaaggtatctggagcaacattgtctccctg
aacttgctggatctctggcatggcctcaccagctccggggaagcctggaaacagcacatc
cgggacaagatgaggagcatggaggagccccctgcctcctcagagacctcctcataccta
gaggcctcgtggctgcagcctggaacggcactggcccaagccttcaaggacttcctgata
aacaggccgctctaccagtgcagccccaacttcctccatggcntccagctgcaccaggac
tactaccaccagaaagacttctctacctgggcagactgccagctggatggcacccccagc
cagctgaccctccaggagacacagctctgcctggtggacagtggctacttcatcaacacc
agctgcccctccatgttccgaccaggccgcaagctggacctcatcctcttctttgactac
tccttgtcctcatcctttgaggtgctgcagcagactgagctgtactgccgggcccatggg
ctgcccttcccccgcgtggagctgaaccctcaggaacttcgccagaccggggagtgctac
ctcttctccgaccctgaccgccctgaggcccctgtcctgctctacttcccgctggttaac
gcctccttcaaggaccactcggcccctggtgtccagcgcagctctgcagagctccagact
ggccaagtggatctcaccagggccacctcaccctattccacgttcaacatgacgtacaag
gaggaagactttgaccgcctgctgcacctcagtgactacaatgtgcggaacagccaggac
accatcctgcaggccttgagaatggcactgaagcaccatgcctcggcgaacaggcctcca
gaggtgcagacatga

KEGG   Loxodonta africana (African savanna elephant): 100675410
Entry
100675410         CDS       T04351                                 

Gene name
PLA2G4F
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100675410 (PLA2G4F)
   00565 Ether lipid metabolism
    100675410 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100675410 (PLA2G4F)
   00591 Linoleic acid metabolism
    100675410 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100675410 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675410 (PLA2G4F)
   04014 Ras signaling pathway
    100675410 (PLA2G4F)
   04370 VEGF signaling pathway
    100675410 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100675410 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100675410 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675410 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100675410 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    100675410 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675410 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100675410 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100675410 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675410 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100675410 (PLA2G4F)
   04726 Serotonergic synapse
    100675410 (PLA2G4F)
   04730 Long-term depression
    100675410 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675410 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100675410 (PLA2G4F)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100675410 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100675410
NCBI-ProteinID: XP_003418805
LinkDB
Position
Unknown
AA seq 849 aa
MLWALWPRWLAGRGLPLLGAVLLRKREKKGPQWRHWQQETHPYYDLQVKVLRARNIRDTD
LLSKADCYVQLWLPTASPSTAQTKTVANCSDPEWNETFHYQVHGAVKNVLELTLYDKDVL
GSDRLSLLLFDLRSLKPGQPHRHTFSLNHKDSQELQVEFVLEESQVPASEVITNGVLVAQ
PCLRIQGTLGEHGTALHREYGHRHIQLAVPGAYEKPQLLPLQPAVELGFPPTFTFHVNPV
LSSRLDVELGEKLTILQSGPSAELESQASNLGEGSILLSSLPLGQEEQCFVALGEGQEVA
LSVKAEMSSGDLDLRLGFDLCDGEQEFLDKRKQVVSKGLQQVLGLSGAPDSDQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGFLDTVTYLSGVSGSTWCMSTLYSDPAWSHVALQGPIE
RAQARVCSSKMGAVSTERLQYYAQELGARESSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVSQGQNPYPIYASVNVRTNISGEDFAGTWVHPYEVGFPKYGAYVPTELFGSVVFM
GRLMWSRPEPRICYLQGMWGSAFAASLNEIFLKTTGSGLSFLDSYRGSVNIMDDSQKLWL
HDSSQLHTRLFTPQGPFSQAVLDLFTSRFTSAENFNFTRGLCLHKDYVACREFMAWKDSH
PDAFPNQLTPMRDCLCLVDGGFAINSPFPLALLPQRAVDLILSFDYSLDAPFEVLQMTEK
YCLDRGIPFPKIVVCPGDLEEPRECYLFTNAEDPRSPIVLHFPLVNHSFRTHLAPGVERQ
TAEEKAFGDFVVNRPDTPYGMMNFTYEPQVFARLVALSRYNVLNNAETVRHALRLALDRR
QQAGERAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggctggcgggcagggggctgcccctcttgggggca
gtgctgctgcggaagagagagaagaaaggacctcagtggagacactggcagcaggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccaggaacatccgggacacagac
ctgctgtccaaagctgactgctatgtgcaactctggctacccacagcgtcccccagcacc
gcccagacaaagacggtggccaactgcagtgacccggagtggaatgagaccttccactac
caggtccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggatgtcctg
ggcagtgaccgactctccctgctcctgtttgacctgaggagcctcaagccaggccaaccg
cacaggcacaccttctcactcaaccacaaggattcacaagagctgcaagtggaatttgtt
ctggaggagagccaggtgcctgcgtctgaagtcatcaccaatggggtcctggtggctcag
ccctgtctgagaatccagggcacccttggggaacatggaacagccctacatcgagagtat
ggccatcggcacatccagctggcagtgcctggcgcctacgagaagccacagctcttgcct
ctgcagcctgctgtggagctgggcttcccgcccacttttaccttccacgtgaacccagtg
ctaagctccaggctggatgtggagctgggagagaagctcaccatcctgcagagcggcccg
agtgctgagctggagtcccaggccagcaatctgggcgaggggagtatcctgctctcctct
ttgcccctaggccaggaggagcagtgcttcgtggccctgggggagggccaggaggtggcg
ctgagtgtgaaggcagaaatgagctctggggaccttgacctgcgccttggctttgacctc
tgtgacggggagcaggagtttctggacaagaggaagcaggtggtgtccaagggcctgcag
caggtgctgggactcagtggggctccagacagtgaccaggtgcctgtggtggctgtgctg
ggttctgggggtggaacacgagccatgtcttccctgtacggcagcctggcagggctgcag
gagctgggcttcctggacactgtaacctacctcagtggtgtctctgggtccacctggtgc
atgtccaccctctacagtgacccagcctggtcccacgtggccttgcagggccccattgag
cgtgcccaggcccgagtctgcagcagcaagatgggggcagtgtccacagagcggctgcag
tactatgcccaggaactgggagcccgtgaaagcagcggccacagcgtttccctcatcgac
ctgtggggcctccttgtggagtatttcctgtaccaggaggaaaacccagccaagctgtct
gaccagcaggaggcagtcagccagggtcagaacccttaccccatttatgccagtgtcaac
gtccgcaccaacatcagtggggaagactttgcgggtacatgggttcacccttatgaggtc
ggcttccccaagtatggggcttatgtccccactgaactcttcggctctgtagttttcatg
gggcggctgatgtggtcccgtccagagccccggatctgctacctgcagggtatgtggggc
agcgcctttgcggccagcctgaatgagatcttcctgaagaccaccggctccggcctcagc
ttcctggactcgtacaggggcagcgtaaacatcatggatgactcgcagaagctctggctg
cacgactcctcccagttgcacacaaggctcttcaccccccaggggcccttctcccaggct
gtcctggacttgtttacctcccgctttacctctgcggagaactttaacttcacccggggc
ctctgcctacacaaggactatgtggcttgcagggagttcatggcctggaaagactcacac
ccagatgccttcccgaaccagctcacccccatgagggactgcctgtgcctggtggatggg
gggtttgccatcaactctccattcccactggctttactgcctcagagggctgtggacctc
atcctgtcctttgactactccttggatgctccttttgaggtcttacagatgacagagaag
tactgcctggaccggggaatccccttccccaagatcgtggtgtgtccgggggacttggag
gaaccccgcgagtgctatttgtttactaatgctgaggacccccgctcacccattgtgttg
cacttccccctcgtcaaccacagctttcgcacacacctggccccaggtgtggagcggcaa
acagctgaggagaaggccttcggggactttgtcgtcaacaggccagacaccccctatggc
atgatgaactttacctatgagccccaggtgtttgctcggctggtggccctgagtcgatac
aatgttctgaacaatgcagagaccgtgaggcatgctctccggctggctctggaccggcgg
cagcaggctggggagagggctgggggctga

KEGG   Loxodonta africana (African savanna elephant): 111753010
Entry
111753010         CDS       T04351                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111753010 (PLA2G4B)
   00565 Ether lipid metabolism
    111753010 (PLA2G4B)
   00590 Arachidonic acid metabolism
    111753010 (PLA2G4B)
   00591 Linoleic acid metabolism
    111753010 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    111753010 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111753010 (PLA2G4B)
   04014 Ras signaling pathway
    111753010 (PLA2G4B)
   04370 VEGF signaling pathway
    111753010 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    111753010 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111753010 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111753010 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    111753010 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    111753010 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111753010 (PLA2G4B)
   04913 Ovarian steroidogenesis
    111753010 (PLA2G4B)
   04921 Oxytocin signaling pathway
    111753010 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111753010 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    111753010 (PLA2G4B)
   04726 Serotonergic synapse
    111753010 (PLA2G4B)
   04730 Long-term depression
    111753010 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111753010 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111753010 (PLA2G4B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111753010 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B HRM
Other DBs
NCBI-GeneID: 111753010
NCBI-ProteinID: XP_023414467
LinkDB
Position
Unknown
AA seq 573 aa
MEMGSSLMRLSAASWSLPSCPRPGELAVRLGCGPCTEEQAFLSRRKQVVARALQQALQLE
GDLQEDEVPVVAVMATGGGIRAMTSLYGQLAGLRELGLLDCISYITGVSGSTWTLANLYE
DPEWSQKDLAGPIELLKTQVTKSKLGVLAPSQLQRYEQELTERARLGYPACFTNLWALIN
EALLHDGPYDHKLSDQREALRHGQNPLPIYCALNTKEQSLSTFEFGEWCEFSPYEVGFPK
YGAFIPAELFGSEFFMGRLMKQLPESRICFLEGLWTNLYAANLQDSLYWSSDPSQFWDRW
AQNQASLDKEQVPILKIEDPPSMTGRIAAFFTDLLTWRPLAQVTHNFLHGLHFHKDYFQH
PHFSTWKATKLDGLPNQLTPMEPHLCLLDVGYFVNTSCPPLLQPTRDVDLILSFDYNLQG
AFQQLQLVSRFCQEQGIPFPPVSPSPEEEYQPRECHEFSDPHRPEAPIILHFPLVNDSFR
EHSAPGVRRTPEEEEAGQVNLSPSDSPYHYTKVTYSQENVDKLLGLTYYNICNNRELLLA
ALREAMQRRRQRRLRGPSDSSLPGCPSGSVPPE
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggaaatgggatcttctctgatgaggctgagtgcggcctcatggtccctcccttcctgc
cccagaccaggggagctggctgtgcggctgggctgcgggccctgcaccgaggagcaggcc
ttcctgagcaggaggaagcaggtggtggccagggcactgcagcaggccctgcagctggag
ggcgacctgcaggaggacgaggtcccagtggtagctgttatggccactggtggagggatc
cgggcaatgacctccctatatgggcagttggctggcctgagggagctgggcctcttggat
tgcatctcttatatcacgggagtctcgggctccacctggaccttggccaacctctatgag
gatccagagtggtctcagaaggacctggctggacccattgagttgctaaagacccaggtg
accaagagcaagctgggcgtgctggcccccagccaactgcagcggtacgagcaggagctg
actgagcgagctcgcctgggctacccggcctgcttcaccaacctatgggccctcatcaac
gaggcgctgctgcacgacgggccctatgaccacaaactttcggatcagcgggaggccctg
cgtcacggccagaaccctctgcccatctactgtgccctcaacaccaaggagcagagcctg
tccacctttgaatttggggagtggtgtgagttctccccctacgaggtcggcttccccaag
tacggggccttcatccctgctgagctcttcggctctgagttcttcatgggacggttgatg
aagcagctccctgagtcccgcatctgtttcctggaaggtctctggaccaacctgtatgca
gccaacctccaggacagcttatactggtcctcagatcccagccagttctgggaccgctgg
gctcagaatcaggccagcctggacaaggagcaggtccccatcctgaagatagaagaccca
cctagcatgactggaaggatagcagcgtttttcactgacctcctgacttggcgcccactt
gcccaggtcacccacaacttcctgcatggcctccatttccacaaagactattttcagcac
cctcacttctccacctggaaagccaccaaactggacgggcttcctaaccagctgacaccc
atggagcctcacctttgcctgctggatgtcggctactttgtcaacaccagctgcccgccc
ctcctgcagcccacacgggatgtggacctcatcctttcatttgactacaacctccaagga
gcctttcagcagctgcagcttgtcagccggttctgccaggagcaggggatcccgttcccg
cctgtctccccgagcccggaggaggagtatcagcctcgggagtgccatgagttctcggac
ccccaccgccctgaggcccccatcatcctgcacttcccactggtcaacgactccttccgg
gagcactcggcccccggggtccggaggacaccggaggaggaggaggcagggcaggtgaac
ctatctccatccgactccccctaccactacacgaaggtgacctacagccaggagaacgtc
gacaagctgctcggcctgacgtactacaacatctgcaacaaccgtgagctgctcctggca
gccctgcgtgaggccatgcagcggagaaggcagcgcaggctgcgtggcccgagtgacagc
tcactgcctggctgccccagcggctctgtgccacccgagtga

DBGET integrated database retrieval system