KEGG   Loxodonta africana (African savanna elephant): 100658524
Entry
100658524         CDS       T04351                                 

Gene name
ARHGEF6
Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04810  Regulation of actin cytoskeleton
lav05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100658524 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100658524 (ARHGEF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658524 (ARHGEF6)
Membrane trafficking [BR:lav04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100658524 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF RhoGEF67_u1 CH SH3_2 SH3_9 SH3_1 PH CAMSAP_CH DUF2204 ZapB
Other DBs
NCBI-GeneID: 100658524
NCBI-ProteinID: XP_010598341
LinkDB
Position
Unknown
AA seq 803 aa
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLVPGSVEKYCLEP
QTEADCTNNINDFLKGCATLQVEVFDPEDLYLGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSSANSSQTNPQGAVSSTAPGLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAGKGLETAPLTKN
YYAVELEMKVVPASRRSWEMGQDSSTGGGSETVDPYVLQNILDTEKEYAKELQSLLVTYL
RPLQSNNNLSSVEFTSLLGNFEEVCTFQQTLCQALEECSKFPENQQKVGGCLLNLMPHFK
SMYLAYCANHPSAVNVLTQHSDDLDQFMESQGASSPGILILTTSLSKPFMRLEKYVTLLQ
ELERHMEDTHPDHQDILKAIVAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGEDIKTLG
NVIFMSQVMVQCGACEEKEERYLMLFSNVLLMLSASPRMSGFIYQGKISIAGMVVTRLDE
IEGNDHTFEITGNLTERLVVHCNNSQDLQEWLEQLCKLTRGPASCSSLSKTSSSCSAHSS
FSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKF
LHKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGTRKDSVPQVLLPEE
EKLIIEETRSNGQTITEEKSLVDTVYALKDEVKELKQENKRMKQCLEEELKSRRDLEKLV
RRLLKQTDECIRAESSSKTSILP
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgaatccagaagagagaatcgtgacatggcttatctctctgggagttttagattctccc
aaaaagaccatctgtgatccggaggagttcttgaagtcctcgctgaaaaatggggtagtg
ctgtgtaaacttatcaacagacttgttcctggctctgtggaaaagtattgcctggagccc
caaaccgaagcagactgcaccaacaacatcaatgacttcctgaaaggatgtgcaacactt
caagtggaggtatttgatcctgaggacctttatttgggggtcaatttctccaaagttctg
agcacccttttagctgtcaacaaagcaacagaagatcagctctcagaaagaccatgtgga
cgttcctcttctcttagttctgctaatagttctcagacaaacccacagggagcagtttct
agcacagctccaggactgcaaaggcagtccaaggcagtggagatgacggaaaatggaagt
caccagttgatagtaaaggcaagattcaattttaagcagactaatgaagacgaactgtca
gtctgtaaaggggacatcatttatgtcactcgagttgaagaaggtggctggtgggaaggc
accttaaatgggagaacaggctggttccctagtaattatgtccgagaaattaaatccagt
gagcgacctctctccccgaaggctggcaaaggacttgaaactgctccgcttaccaagaat
tactatgctgtggagcttgaaatgaaggttgttcctgcctccagaagaagctgggaaatg
gggcaagactccagcactggcgggggaagcgaaactgtggatccatacgtgttacagaac
atcttggacactgaaaaagagtatgctaaagaacttcagtctcttcttgttacttactta
agacccctgcagtccaacaacaatctgagtagtgtggagttcacatctttattgggaaac
ttcgaagaagtatgcacatttcaacagacgctctgccaagccttggaagaatgttccaag
tttccagaaaaccaacagaaagtgggaggttgtctgctgaacctcatgcctcattttaaa
tccatgtatctggcttattgtgcaaaccatccttcagcggtaaatgtgctcacacagcac
agtgatgacctggatcaatttatggaaagtcaaggtgcctccagccctggcatcctcatt
ttaacgaccagcctcagcaaaccattcatgcgactggaaaagtatgttactctcttgcaa
gagctggaacggcatatggaggacacgcatccagatcatcaggacattctgaaagcaatt
gtagccttcaaaacgctcatgggacagtgccaagatctgaggaagagaaaacagctggag
ttgcagatactttctgaacctattcaggcatgggaaggggaggatattaaaaccttggga
aacgtgatttttatgtcacaagtaatggtgcagtgcggagcatgcgaggaaaaagaggag
cggtacctcatgttattttcaaatgttttgctaatgctttctgcaagtcctcggatgagt
ggctttatctaccagggaaaaatatcaatagcaggaatggtggtgacaagattagatgaa
attgaagggaatgaccacacatttgaaatcacaggtaacctgacagagagactggtggtc
cactgcaacaacagtcaggacttacaggaatggctggagcagctctgcaaactgacccga
ggacctgcctcttgcagttcgttgtccaaaacctcgtcatcctgcagcgctcattcctct
tttagctctactggacagccccgaggacccttggagcctcctcaaattataaaaccgtgg
agtttaagttgtctacgacctgcacctccacttagaccatcagcagcactaggttataaa
gagaggatgtcttatatcttaaaggagtctagtaaaagtcccaaaacgatgaagaagttt
cttcataaaagaaagaccgaaagaaaaccatcagaggaggaatatgtgattaggaaaagt
acagctgctctagaagaggacgctcagattctcaaagtgatcgaagcctactgtaccagc
gcaaatttccaacaaggtactcgcaaagattctgttccacaagtcttactccctgaggaa
gagaaactcatcattgaagaaaccagaagtaatggccagaccatcactgaagagaagagc
ctcgttgacactgtttatgccttgaaggatgaggtcaaagaactgaagcaggagaataaa
agaatgaagcaatgcctggaagaagaattgaaatcaagaagggacctagaaaagctggtc
cggaggttgctgaagcaaacggatgaatgtattcgggctgagtccagtagcaagacctcg
attcttccataa

DBGET integrated database retrieval system