KEGG   Loxodonta africana (African savanna elephant): 100658653
Entry
100658653         CDS       T04351                                 

Gene name
SHANK1
Definition
(RefSeq) LOW QUALITY PROTEIN: SH3 and multiple ankyrin repeat domains protein 1
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100658653 (SHANK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100658653 (SHANK1)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100658653 (SHANK1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank SH3_2 Ank_3 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 100658653
NCBI-ProteinID: XP_023399844
LinkDB
Position
Unknown
AA seq 1013 aa
MPVVLVTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIR
TLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVG
GDPRCCELLLYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTAL
HICALYNKETCARILLYRGANKDVKNNNGQTPFQVAVIAXNFELGELIRNHREQDVVPFQ
ESPKYAARRRGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGTSSSGAPGPTSGPQGQ
SQPSAPSTKLSSGTLRSASSPRGARARSPSRGRHPEEAKRQPRGRPSSSGTPREGPAGGT
GGSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGF
WEGQVKGRVGWFPSDCLEEVANRSQEGKQESRSDKAKRLFRHYTVGSYDSFDAPSTPAGT
LWSCRGIPPNMRPPPQSPLSVGVHGSHCVADVACRSVVVGCLSPPGASLAGGIPAGQWGL
VRASLHAVARHLCDEHGGRGQGAFSPRELMAGPPPSHFSAPQQAKRLPPPAISLRSKSMT
SELEEMEYEHQPAPMPSMEKKRTVYQMALNKLDEILAAAQQTISASESPGPGGLASLGKH
RPKGFFATESSFDPHHRSQPSYERPSYLPPGPGLMLRQKSIGAAAEDDRPYLAPPAMKFS
RSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSLRGGPFNPSSGVTHPASSPSS
FDGPAPPDTRVGGREKSLYHSGPLPPAHHHPPHHHHHHAPPPWAHQKDAHAVLGSKKEMA
LLTPSKLRGRALGSSGGLRPGPSSGLRDPVTPTSPTVSVTGAGTDGLLALSGCAGPPTAG
VAGGPLSVEPEGPPMPLPTASSLPRKLLPWEEGPGPPPPPLPGPLAPPQASALATVKASI
ISELSSKLQQFGGSTAAGGALPWARGGSGGSGDSHHGGASYVPERTSSLQRQR
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgcccgttgttcttgtgacggggttgaagaagttcctggagtatgtgcagctcgggacg
tccgacaaggtggcacggctgctggacaaggggctggaccccaattatcatgactcggat
tcgggagagacccctttgacgctagctgcgcagaccgaaggctccgtggaggtgattcga
accctgtgcctgggcggggcccacatcgacttccgggcgcgggatggcatgacggcgctg
cacaaagccgcgtgcgcacgccattgccttgctctcacggcacttctggaccttgggggc
tcccccaactacaaggaccgccgggggctgacccctctgttccacacggctatggtgggg
ggcgaccctcgctgctgtgagctgctactgtacaacagagcccagctgggcatcgctgat
gagaacggctggcaggagatccaccaggcctgccagcggggtcactcccagcacctggaa
cacctgctcttctatggggctgagcccggagcccagaacgcctcggggaacacagcactg
catatctgcgccctctacaacaaggagacctgcgccaggatcctcctgtaccgaggggcc
aacaaggacgtgaagaataacaatggacagacccccttccaggtagcagtgatcgctngg
aattttgagctgggggagctaatccgaaaccatcgagagcaggatgtggtgcccttccag
gagtcccccaagtatgcagcccggcggcgaggacccccgggtgcagggctgacagtgccc
cccgcgttgctgcgagccaacagtgacaccagcatggccctgcccgactggatggtcttc
tcagccccagggacctcgtcctctggggcccccggcccaacttcagggccccagggccag
tcacagccctcagcccccagcaccaagctcagcagcgggacactccgaagtgccagcagc
ccccggggagcccgggcccgctccccctcccgtgggagacaccctgaggaggccaagagg
cagccccgtggacggcccagctccagcgggacgcccagagaagggccggccgggggcaca
gggggctcagggggccctgggggctccctgggcagtcgcgggagacggaggaaactctac
tcggctgtacctggacgctctttcatggcggtgaagtcataccaggctcaaggcgagggg
gagatctccctgagcaagggcgagaaaatcaaagtgcttagcatcggggaaggaggcttc
tgggaaggtcaagtcaaaggtcgtgttggctggtttccctctgactgcctggaagaggtg
gcaaaccgctcccaggaggggaagcaagaaagccgcagcgacaaggcaaagagactcttc
cgacattatactgtgggctcctacgacagcttcgatgccccaagcacccctgctggaacc
ctgtggtcctgccgtggtatccctcctaacatgcgtcccccgccccagtctcccctctcc
gtcggtgtccatggctcccactgtgttgcggacgtggcgtgtcggtctgtggtggtgggc
tgcttgtcccctcctggggcctctctcgccggtggcatccctgccgggcagtggggcttg
gtccgcgcgtccctgcacgcggtcgcgaggcatctgtgtgatgagcacggagggagaggt
caaggggccttctcccccagggagctgatggctggccctcccccctcccatttttcagca
cctcagcaggcgaagaggctcccacccccggccatctccctgcgttccaagtccatgacc
tcggagctggaggagatggagtacgagcaccaacctgcaccaatgcccagcatggagaaa
aaacggaccgtgtatcagatggctctcaacaaactggatgaaatcttggcagcagctcaa
cagaccatcagtgcaagcgagagtcctgggcctggtggcctggcgtccctgggcaaacac
cggcccaagggcttctttgccactgagtcgagcttcgatccccatcaccgctcccagccg
agttacgaacgtccttcatacctgcccccaggacctgggcttatgctccggcaaaaatct
atcggggctgctgcggaggatgacagaccctacctagcgcccccagccatgaagttcagc
cgcagcctatctgtgcctgggtcggaggacattcctccgccgcccaccacgtcccctcca
gagcccccctacagcacaccacctgccccttcctcctctggccgcctcaccccctccctc
cggggaggccccttcaaccccagctcaggggtcacccacccagcctcctccccctcctcc
tttgatgggcccgcccctcccgacacccgtgtggggggccgggagaagagcctataccac
agcggacccctgccccctgcccaccaccacccgccgcaccaccaccaccaccacgccccg
ccgccgtgggcccaccaaaaagatgcccacgcagttttgggaagcaagaaagaaatggcc
ctcttgacaccctctaagctcaggggaagggcactggggagcagcggaggcctgcggccc
ggccccagtagtggactccgggacccggtcacccccaccagccccactgtttcagtgaca
ggggctggaaccgatggactgctggccctgagtggctgtgcaggacccccgacagcaggt
gtggccgggggtcccttgtctgtagaaccagaaggcccacccatgcccttgccaacagcc
tcctccctgcctcgaaagctgctaccttgggaggagggtccaggcccaccaccaccaccc
ctgcccgggcccttggccccacctcaagcctcagccttggcgacagtcaaagccagcatc
atcagtgaactcagctccaagctccagcagtttgggggctccacagcagctggtggcgct
ctgccctgggcccggggaggcagcgggggaagcggggacagccaccatgggggagccagc
tatgtacctgagaggacttcctccctgcagcggcagaggtga

KEGG   Loxodonta africana (African savanna elephant): 100662070
Entry
100662070         CDS       T04351                                 

Definition
(RefSeq) SH3 and multiple ankyrin repeat domains protein 2
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100662070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100662070
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100662070
SSDB
Motif
Pfam: SAM_1 SAM_2 PDZ_6 PDZ SAM_4 SAM_PNT
Other DBs
NCBI-GeneID: 100662070
NCBI-ProteinID: XP_003422666
LinkDB
Position
Unknown
AA seq 1251 aa
MMNVPGGGAAAVMMVGHNNGRCPRNSLYSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTP
IEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGG
NHLVLKVVTVTRNLDPDDTARKKAPPPPKRAPTTALTLRSKSMTSELEELVDKASVRKKK
DKPEEIVPAAKLSRAAENVAVESRVATIKQRPASRCFPSIVDVNSIYERQGIAVMTPTVP
GSPKGPFLGLPRGTMRRQKSIDSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIPP
PPQSVPPSPPPPSPTATVYNCPKSPTPRVYGTIKPAFTQNPAAKVSAAARSDTVAATMRE
KGAYYRRELDRYSLDSEDLYNRNAATATQANFRGKRGQMPENPYSEVGRMANKAVYVPAK
PARRKGVLVKQPNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMETDTQAAEQPGQ
LRPDDSLGGSSPFAAAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGLPAPRTRPSK
FPEEGGFGDEDGTEQLASPSLGPAPREPENHFISGGEAGTQDEPGRPLNPTSKAKGPESG
PENYVHPLTGRLLDPSSPLALALSARDRAMKESQQGPKGEAPKADLNKPLYIDTKMRPSM
EPAFPPVSRQNTRGPLRRQETENKYETELGRERKGDDRNMLVTIMDTSQQRSAGLLMVHT
VDAAKSDGSLEEEDQKEQAETQADHSPPEVPEGVSKTDGALQLSAAPEPAAAPGRAMVAA
GSMEETVVLPFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRAASVPALAELV
KQKKHDAPQSPSLNSSQPANSVGGKKPAALSNCLPAPFLPPPESFDAVTDSGIEEVDSRS
SSDHHLETTSTMSTVSSISTLSSEGGENADTCTVYADGQAFVVDKPPVPPKPKMKPTIHK
SNTLYQDALVEEDADSFIIPPPAPPPPPGGAQPSTAKVVQPRTSKLWGDITEVKIPILSG
PKANVISELNSILQQMNREKSAKPGEGLEAPTGGKPAGLALRSPEVMSTVSGTRSTTVTF
TVRPGTAQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNKEILPAPLSAAAASPSPSLS
DVFSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESL
NLGEHKETFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgatgaacgtccccggcggaggagcggccgcggtgatgatggtgggtcacaataatggt
cgctgtccccggaattctctctacagtgactgcattatcgaggagaagaccgtggtgctg
cagaagaaagacaatgagggcttcggattcgtgctccgcggggccaaagctgacacgccc
attgaagaattcacaccgacaccggctttcccggccctgcagtacctggagtccgtggat
gaaggcggggtggcttggcaagccggactgaggacgggggacttcctgatcgaggtcaac
aacgagaacgtcgtgaaggtgggccacaggcaggtggtgaacatgatccgccaggggggg
aaccacctggtcctcaaggtggtcacggtcacccggaatctggacccggatgacacagcc
aggaagaaagctccccctccgcccaagcgtgctccgaccactgcgctcaccctgcgctcc
aagtccatgacctcggaactagaggagctcgtggataaagcttccgtccggaagaagaag
gataagcccgaggagatcgtcccggccgccaagctgtcgagggccgccgagaacgtggcc
gtggagtccagggtggccaccatcaaacagcggcccgccagccggtgcttcccgtccatc
gtcgacgtgaattccatttatgaacgccaggggatcgccgtgatgacacccaccgttcct
gggagcccaaaaggcccgtttctgggcctccctcgaggtacgatgcgaaggcagaaatcc
atagacagcagaatctttctgtcagggataacggaggaagagcggcagtttctggcccct
ccaatgctcaagttcaccaggagcctgtccatgcccgacacctccgaggacataccccct
ccgccccagtccgtgcccccgtctccaccgccaccctcccccactgccactgtgtacaac
tgccccaagtccccgacgcccagagtctacgggaccatcaagcccgcctttacacagaat
cccgctgccaaggtctcggcggctgcccgctccgacacggtggctgccaccatgagggag
aagggtgcctactacaggcgagagctcgaccggtactccctggactccgaggacctgtac
aaccggaacgccgccaccgccacccaggccaacttccgcggcaagcggggccagatgccc
gagaacccgtactcggaggtgggcaggatggccaacaaggccgtgtacgtgccggccaag
cccgcacggcgaaagggcgtgctggtgaagcagcccaatgtggaggacagccccgagaag
acgtgttccatccccatccccaccatcatcgtcaaggagccctccaccagcagcagcggc
aagagcagccagggcagcagcatggagaccgacacgcaggccgccgagcagcccgggcag
ctgcggccagatgacagcctgggcggcagcagccccttcgcagccgccatcgccggggcc
gtgcgcgaccgggagaagcggctggaggcccggaggaactccccggccttcctctccacg
gacctgggggacgaggatgtggggctggggctccccgcgcccaggacgcggccttccaag
ttccccgaggagggcgggtttggcgacgaggacggcaccgagcagctggcatcaccctcg
ctggggccagcgcccagggagcccgagaaccactttatcagtgggggcgaggctggcact
caggacgagcctgggaggccgctgaatcccacgtccaaagccaagggccccgagagcggc
cccgagaattacgtccacccgctcacggggaggctgctggaccccagctcccctctggcc
ctagcgctgtccgccagggaccgggccatgaaggagtcccagcaggggcccaagggggag
gcccccaaggccgacctcaacaagcccctgtacatcgacaccaaaatgcggcccagcatg
gagccggccttcccgcccgtaagcaggcagaacacccggggccccctgcggcggcaggag
acggagaacaagtatgagacggagctgggccgagagcggaagggtgatgacaggaacatg
ctggtcaccatcatggacacgtcccagcagaggtcggccggcctgctcatggtccacacc
gtcgacgccgccaagtcggacggctccctggaggaggaggaccagaaggagcaggcagag
acgcaggcggaccactctccacccgaggtgccagaaggtgtctccaaaaccgacggtgct
ttgcagctctcagctgcccccgagccggccgccgcgcccggcagagccatggtggcggcc
ggctccatggaggagacggttgtcttgccgttccgcatccctcccccacctctggcctct
gtggacttggatgaagattttatctttacagagccattgcctccgcccctggaatttgca
aacagttttgatatccccgacgaccgcgccgcttcggtccccgctctggccgagttggtc
aagcagaagaaacacgatgcccctcagtccccttcgctgaactccagccagcccgccaac
tcggtaggcggtaagaagccagctgctctctccaactgcctgcctgccccgttcctgcca
ccccccgagagttttgacgctgtcacagactcaggcatcgaggaggtggacagccggagc
agcagcgaccaccacctggaaacaaccagcaccatgtccaccgtgtccagcatctccacc
ttgtcctccgagggcggtgagaacgcagacacctgcacggtctacgcggacggacaagcc
ttcgtggtcgacaagcccccagtacctcccaagccaaaaatgaaacccaccatccacaaa
agcaacaccctttaccaggacgcgctggtggaggaggacgcggacagcttcatcatcccc
ccgccggccccgccccccccgcccggaggggcccagcccagcacggccaaggtcgttcag
ccaaggacctccaaactatggggcgacatcacggaggtcaagatccccattctctcaggc
ccaaaggcaaacgtcattagtgaattgaactcaatcctgcagcaaatgaaccgagagaaa
tcggccaagccgggagaaggactggaggcaccgacgggaggcaaacctgccggactcgct
ctaagaagcccggaggtcatgagcaccgtctcaggtacacggagcactacggtcaccttc
actgttcgccctggcaccgcccagcccatcaccctgcagagccggcccccggactatgaa
agtaggacctcaggaacaagacgtgccccgagccctgtggtctcgccaacagagatgaac
aaagagatcctgcctgcccctctatctgctgctgctgcgtctccttccccctctctctca
gatgtctttagccttccaagccagcccccttctggggacctatttggcttgaacccagcg
ggacgcagcaggtcaccatcaccctcaatactgcaacagccaatctcaaataagcctttt
acaactaaacctgtccacctgtggactaaaccagacgtggcagattggctggaaagtcta
aacttgggtgaacacaaagagaccttcatggacaatgaaatcgatggcagccacttacca
aaccttcagaaggaagacctaatagaccttggggtgacccgggttggacacagaatgaac
atagagagggctttgaaacagctgctggacagataa

KEGG   Loxodonta africana (African savanna elephant): 104847189
Entry
104847189         CDS       T04351                                 

Definition
(RefSeq) SH3 and multiple ankyrin repeat domains protein 3-like
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    104847189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    104847189
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   104847189
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank FERM_f0
Other DBs
NCBI-GeneID: 104847189
NCBI-ProteinID: XP_023397585
LinkDB
Position
Unknown
AA seq 393 aa
MPRSPTSSEDEMAQSFSDYSVGSESDSSKEETVYDTIRATAEKPGGARTEESRGDTLVLR
IIIQDLQQTKCIRFNPDATVWVAKQRILCTLNQSLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPVGKGVPSLEFRYKKRVYKQPNLDEKQLAKVHTKTNLKKCMDHVQHRSVEKIV
KMLDRGLDPNFHDLETGETPLTLAAQLDGSMEMIKALKNGGAHLDFRAKDGMTALHKAAR
TRNQAALKTLLELGASPDYKDSCGLTPLYHTAIVGGDPYCCELLLHEHATVCCRDENGWH
EIHQACRYGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQDSCARVLLFRGGNKELK
NYNSQTPFQVAIIAGNFELAEYIKNHKETDVGT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgccacgaagtcccacgtccagcgaggacgagatggcccagagcttctctgactactct
gtgggctcagagtccgacagctccaaagaagagacggtctatgacaccatccgggccaca
gccgagaagccgggcggcgccaggacagaggagagccggggcgacacactggtgctgcgg
attattattcaggaccttcagcagacgaagtgcatccgctttaaccccgacgcgaccgtg
tgggtggccaagcagcggatcctgtgcacgctgaaccagagcctgaaggacgtcctcaac
tatgggctcttccagcccgccagcaacgggcgcgatggaaagttcctggacgaagagcgc
cttctccgcgagtacccgcagcccgtgggcaagggggtgccatcgctggagtttcgatac
aagaagcgggtgtataaacaacccaatcttgatgagaaacagttggccaaggtacacacg
aagaccaatctgaagaaatgcatggaccacgttcagcatcgctcggtggagaaaatagtc
aagatgctcgatcgaggcctggaccccaatttccacgacctggagactggagagacgccc
ctgaccttagccgcccagttggacggctccatggagatgatcaaagcgctcaaaaatggt
ggtgctcatctggacttccgtgccaaagacgggatgaccgccctgcacaaggccgcccgc
acgaggaaccaggctgcccttaagacccttttagaacttggggcatcaccagattacaag
gacagctgcggcctgaccccgctgtaccacaccgccatcgtcgggggcgacccttactgc
tgtgagctgctgcttcacgagcacgccaccgtgtgctgcagggacgagaacggctggcac
gaaatccaccaggcctgccggtacggacacgtgcagcacctggagcacctgctgttctac
ggggcggacatgggtgcccagaacgcttcggggaacacagcactgcacatctgcgccctc
tacaaccaggacagctgtgcaagagtgcttctcttccgaggtggaaacaaggaactgaaa
aactacaatagccagactcccttccaggtggcaatcatagcgggcaactttgaactggca
gaatacatcaagaaccacaaggagacagatgtcggtacgtaa

DBGET integrated database retrieval system