KEGG   Loxodonta africana (African savanna elephant): 100658815
Entry
100658815         CDS       T04351                                 

Gene name
RUNX2
Definition
(RefSeq) runt-related transcription factor 2 isoform X4
  KO
K09278  runt-related transcription factor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100658815 (RUNX2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100658815 (RUNX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100658815 (RUNX2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100658815 (RUNX2)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 100658815
NCBI-ProteinID: XP_010585655
LinkDB
Position
Unknown
AA seq 343 aa
MAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
IKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSP
FNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVP
RRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHY
HTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSN
GSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcgggtaacgatgaaaactattctgctgagctccgaaatgcctctgctgtcatgaaa
aaccaagtagcaaggttcaacgatctgagatttgtgggccggagtggacgaggcaagagt
ttcaccttgaccataactgtcttcacaaatcctccccaagtagccacctatcacagagct
attaaagttacggtggatggaccccgggaacccagaaggcacagacagaagcttgatgac
tctaaacctagtttgttctctgaccgcctcagtgatttagggcgcattcctcatcccagt
atgagagtaggtgtcccgcctcagaacccacggccctccctgaactctgcaccaagtcct
tttaatccacaaggacagagtcagattacagaccccaggcaggcacagtcctccccgcca
tggtcctatgaccagtcttacccctcctacctgagccagatgacgtctccatccattcac
tccaccaccccgctgtcttccacgcggggtactgggcttcctgccatcactgatgtgccc
aggcgcatttcaggtgcttcagaactgggccctttttcagaccccaggcagttcccaagc
atttcatccctcactgagagccgcttctccaacccacgaatgcactatccagccaccttt
acttacaccccgccagtcacctcaggcatgtccctcggtatgtccgccaccactcactac
cacacctacctgccaccaccctaccccggctcttcccaaagccagagtggacccttccag
accagcagcactccatatctctactatggcacttcgtcgggatcctatcagttccccatg
gtgccggggggagaccgctctccttccagaatgcttccgccatgcaccaccacctcgaat
ggcagcacgctattaaacccaaatttgcctaaccagaatgatggtgttgacgctgatgga
agccacagcagttccccaactgttttgaattctagtggcagaatggatgaatctgtttgg
cgaccatactga

DBGET integrated database retrieval system