KEGG   Loxodonta africana (African savanna elephant): 100658837
Entry
100658837         CDS       T04351                                 

Gene name
NPY
Definition
(RefSeq) pro-neuropeptide Y
  KO
K05232  neuropeptide Y
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04920  Adipocytokine signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100658837 (NPY)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100658837 (NPY)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100658837 (NPY)
   04920 Adipocytokine signaling pathway
    100658837 (NPY)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100658837 (NPY)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 100658837
NCBI-ProteinID: XP_003407124
LinkDB
Position
Unknown
AA seq 97 aa
MLGSKRLGLSGLTLALSLLVCLGALVEAYPSKPDNPGEDAPAEDLARYYSALRHYINLIT
RQRYGKRSSPDTLISDLLMRESTENVPRTRLEDPSMW
NT seq 294 nt   +upstreamnt  +downstreamnt
atgctgggtagcaagcgactggggctgtccggactgacccttgccctgtccttgctcgtg
tgcctgggcgcgctggtcgaggcgtacccctccaagccggacaaccccggcgaggacgcg
ccggcggaggacttggccagatactactcggcgctgcggcactacatcaacctcatcacc
aggcagaggtacggaaaacgatctagccctgatacactgatttcagacctcttgatgagg
gagagcacagaaaacgtccccagaactaggcttgaagatccttctatgtggtga

DBGET integrated database retrieval system