KEGG   Loxodonta africana (African savanna elephant): 100658892
Entry
100658892         CDS       T04351                                 

Gene name
CBL
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04144  Endocytosis
lav04910  Insulin signaling pathway
lav05100  Bacterial invasion of epithelial cells
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100658892 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100658892 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100658892 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100658892 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658892 (CBL)
   05205 Proteoglycans in cancer
    100658892 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100658892 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100658892 (CBL)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100658892 (CBL)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100658892 (CBL)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100658892 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-RING_4 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 100658892
NCBI-ProteinID: XP_003418237
LinkDB
Position
Unknown
AA seq 896 aa
MAGNVKKSSGAGGGGSGGSGSGGLIGLMKDAFQPHHHHHHLSPHPPGTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILARYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAASPNYDDDDDERADDSLFIMKELAGAKVERPP
SPFSMAPQATLPPVPPRLDLLQQRVSIPLSASGPGTASKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSAGAETRPQRRPLPCTPGDCLSRDKLPPVPSSRLGESWLPRPIPKVPVAS
PSPSDPWAGRELTNRHSLPFSLPSQSEPRPDGSRLGSAFSLDTSMNVNSSPLGPECEHPK
IKPSSSANAIYSLASRPLPVPKLPPGEQYENEEDTEYMTPSSRPLETAQSSRVSECDQQI
DNCTYESMYNIQPQAASVMESSTFGEGNLAAAHASTGPEESENEDGGYDVPKPPVPAVLA
RRTLSDISNASTAFGWLSLDGDPTTNFTEGSQVPERPPKPFPRRINSERKAGSSQQGGGA
AAASPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT
NT seq 2691 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaaaaagagctctggggccgggggcggcggctccgggggctccggc
tccggcggcctgatcgggctcatgaaggacgcgttccagccgcaccaccaccaccaccac
ctcagcccccatccgccggggaccgtggacaagaagatggttgagaagtgctggaagctc
atggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagcccacct
tatatcttagacctgctgccagatacctaccagcatctccgtactatcttggcaagatat
gaggggaagatggagacacttggagaaaatgagtattttagggtgttcatggagaatttg
atgaagaaaactaagcagaccataagcctcttcaaggaggggaaagaaagaatgtatgag
gagaattctcagcctaggcgaaacctaaccaaactgtccctgatcttcagccacatgctg
gcagaactcaaaggaatctttccaagtggactttttcaaggggacacatttcggattact
aaagcagatgctgctgaattttggaggaaagcttttggggaaaagacgatagtcccttgg
aagagctttcgacaggccctacatgaagtacatcctatcagttctgggctggaggccatg
gctctgaaatccactattgatctaacctgcaatgactatatttcggtgtttgaatttgac
atctttacacgactctttcagccctggtcctctttgctcaggaactggaacagtcttgct
gtaactcatcctggttatatggctttcttgacatatgatgaagtgaaagctcgactccag
aaattcattcacaaacctggcagttacattttccggctgagctgtactcgtctgggtcag
tgggctattggttatgtcactgctgatgggaacattctccagacaatccctcacaataaa
cctctcttccaagcactgattgatggctttagggaaggcttctatttgtttcctgatgga
cgaaatcagaatcctgacttgacaggcttatgtgaaccaactccccaagaccacatcaaa
gtgacccaggaacaatatgaattatactgtgagatgggctccacattccaactgtgtaaa
atctgtgctgaaaatgacaaggatgtaaagattgagccctgtggccacctcatgtgtaca
tcctgtcttacatcctggcaggaatcagaaggccagggctgtcctttctgccgatgtgaa
attaaaggtactgagcccatcgtagtagatccgtttgatccaagaggaagtggcagcctg
ttgaggcaaggagcagagggagctgcctctccaaattatgatgacgatgatgatgaaaga
gccgatgattctctcttcatcatgaaggagttggctggtgctaaggtggaacgacctcct
tctccattctctatggccccacaagctacccttccgccggtaccaccacgacttgatctt
ctgcaacagagagtatctattcctttaagtgcttctggtcctggaactgcttcaaaggct
gcctctggctcccttcataaggacaaaccattaccaatacctcccacgcttcgagatctt
ccaccaccaccccctccagaccggccatactctgctggagcagaaacccgacctcagaga
cgccctctgccttgtacaccaggcgattgtctgtccagggataaactgccccctgtccct
tctagccgtcttggggaatcatggctgccccggccaatccccaaagtaccagtagcttcc
ccaagccctagtgacccctgggcaggacgagaattaaccaaccggcactcacttccgttt
tcattgccctcacaatcggaacccagaccagatgggtctaggctcggaagcgcattcagt
ctggatacttccatgaatgtgaatagcagcccattaggtccagagtgtgagcaccccaaa
atcaagccttcctcatctgccaatgctatttattctcttgcatccagacctcttcctgtg
ccaaagcttcctcctggggagcagtacgagaatgaggaggacacagaatatatgactccc
tcctctaggcctttggagacagcccagagttcacgagtgagtgaatgtgaccagcaaatt
gataactgtacgtatgaatccatgtataacattcagccccaggcagcatctgtcatggag
agtagtacttttggtgaagggaatttggctgcagcccatgccagtactggccccgaggag
tcagagaatgaggatggtgggtatgatgtccctaagccacctgtgccagcagtactggcc
cgccgaactctctcagatatctctaatgccagcactgcctttggctggctgtctctggat
ggtgatcccacaacaaacttcactgaaggttcccaagttcctgagcggccccccaaacca
ttccctcggagaatcaactctgaacgaaaagctggtagctctcagcagggtgggggtgct
gccgccgcctcacctcagctctccagtgagattgagaacctcatgagtcagggctactcc
taccaggacattcagaaagctttggtcattgcccacaacaacattgaaatggccaaaaat
atccttcgagaatttgtttcgatttcgtctcctgcccatgtagccacctag

KEGG   Loxodonta africana (African savanna elephant): 100669603
Entry
100669603         CDS       T04351                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04144  Endocytosis
lav04625  C-type lectin receptor signaling pathway
lav04660  T cell receptor signaling pathway
lav04910  Insulin signaling pathway
lav05162  Measles
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100669603 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100669603 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669603 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100669603 (CBLB)
   04660 T cell receptor signaling pathway
    100669603 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100669603 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100669603 (CBLB)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100669603 (CBLB)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100669603 (CBLB)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100669603 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 UBA
Other DBs
NCBI-GeneID: 100669603
NCBI-ProteinID: XP_023414848
LinkDB
Position
Unknown
AA seq 1172 aa
MEVGFQMANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMD
KVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSL
MKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRIT
KADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSAKPGSYIFRLSCTRLGQ
WAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIK
VTQVRTVSGKVSESGHFGWRLMPVEVWGKGVRCRAVWAGDSCREKFGERGFSGGPCGLES
HAGRSWGRGGSVAGRVGWRVMQGEVGGEGVQWRAVWAGESCREKLGERGFSGGACGLESH
AGRSWGRGGSVRGAWAGESCREKLGERVFSMVPACDQSQLTGICCTAVTTVFQPVPFTVH
AGRWVVSLPLQHRCDHRVSACAIHWACWDMGGLPALYSTAVTPMFQSVLFTESDGQGCPF
CRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKC
ADRQNSPVTSPGSSPLAQRRKPHPDPLQIPHLILPPVPPRLDLIQKGIARSPCSSPTGSP
KSSPCMVRKQDKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHGESVPSRDQPVPL
EAWCPRDVFGTNQLVGCRLLGDGSPKPGITASSNVNGRHSRMGSDPVIMRKHRCHDLPLE
GAKVFSNGHLGNEEYDVPPRLSPPPPAAALIPSIKCTGPLANSISEKTRDQVDEDDEYKV
PSSHPVSLNSQPSHCHNVKPPIRSCDNGHCILNGTHGTSSEMKKSNIPELGIYLKGDVFD
SASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARH
SVIEHSKPPGSGSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYD
QLPSCPDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVK
RALEIAQNNVEVARSILREFAFPPPVSPRLNL
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggaagtgggattccagatggcaaattctatgaatggcagaaaccctggtggtcgagga
ggaaacccccggaagggccgaattttaggtattattgacgccattcaggatgcagttgga
cctcctaagcaagcagcagcagatcgcaggactgtggagaaaacctggaagctcatggac
aaagtggtaagactatgtcagaatcccaaacttcagttgaaaaatagcccaccctatata
cttgatattttacctgatacatatcagcatttgcggcttatattaagcaaatatgatgac
aaccagaaacttgcccaactcagtgagaatgaatattttaaaatctacatcgatagtcta
atgaaaaagtcaaaacgggcaataagactctttaaagaaggcaaggagaggatgtatgaa
gaacagtcgcaggacagaagaaatctgacaaaactctccctcatcttcagtcatatgctg
gcagaaatcaaagcaatatttcccaatggtcaattccagggagataactttcgtatcaca
aaagcagacgccgctgaattctggagaaagttttttggagacaaaactattgtaccatgg
aaagtattcagacagtgccttcatgaggtccatcaaattagctctggcttggaagcgatg
gctctaaaatcaacaattgatttaacttgcaatgattacatttcagtttttgaatttgat
atttttaccaggctattccagccttggggttctattttacggaattggaatttcttagct
gtgacgcatccaggttacatggcgtttctcacatacgatgaagtgaaagcacggctacag
aaatacagcgccaaacctggaagctacatttttcggttaagctgcactcgattgggacag
tgggccattggctatgtgacgggggatggcaacatcttacagaccatacctcataacaag
cccttatttcaagctctgattgacggcagcagagaaggattctatctttatcctgatggg
aggagttataatcctgacttaactggattgtgtgaacctacaccccatgatcatataaaa
gtcacacaggtaaggacagtttctggaaaagtgtcagaatccggacattttggctggaga
ctaatgccggtagaggtttggggaaagggggttcggtgtcgggccgtgtgggctggagac
tcatgcagggagaagtttggggagagggggttcagtggcgggccgtgtgggctggagagt
catgcagggagaagttgggggagagggggttcagtggcgggccgtgtgggctggagagtc
atgcagggagaagttgggggagagggggttcagtggcgggccgtgtgggctggagagtca
tgcagggagaagttgggggagagggggttcagtggcggggcgtgtgggctggagagtcat
gcagggagaagttgggggagagggggttccgtgcggggcgcgtgggctggagagtcatgc
agggagaagttgggggagagggtgttcagtatggtgccagcatgtgaccagtctcagctt
acaggcatctgttgcaccgctgtgaccaccgtgtttcagcctgtgccattcactgtacat
gctgggagatgggtggtctccctgcccttacagcaccgctgtgaccaccgtgtttcagcc
tgtgccattcactgggcatgctgggatatgggtggtctgcctgccctttacagcaccgct
gtgacccccatgtttcagtctgtgctgttcactgagtcagatggccagggctgccccttt
tgccgctgcgagataaagggaacagagcccataatcgtcgatccctttgacccgagggat
gaaggctccaggtgctgcagcatcattgacccctttggcatgccgatgctggacttggac
gatgacgatgaccgagaagagtccttgatgatgaatcgattggcaaatgttcgaaagtgc
gctgacaggcagaactcaccagtcacatccccaggatcttctcccctggcacagagaaga
aagccccaccccgatcctcttcagatcccacatctaatccttccaccagtgcctcctcgc
ctggatctcattcagaaagggatagctcggtctccctgcagcagcccaactggttcacca
aagtcatctccttgcatggtgaggaaacaagacaaaccactcccagcaccacctcctccc
ttaagagatcctcctccccctccgcctgagagacctccgccaatccctcctgacaataga
ctgagtcgacacttccatcatggggaaagtgtgccttccagagaccagcccgtgcccctt
gaagcttggtgccctagagatgtgtttgggactaatcagttggtgggatgtcgactacta
ggggatggctctcccaagcctggaatcacagcaagttcaaatgtaaatggcagacatagt
agaatgggctctgatccagtgatcatgcggaaacataggtgccacgatttgcctttagaa
ggagccaaggttttttccaatggccacctgggaaatgaagaatatgacgttcctccccgg
ctctctcctcctcctccagctgccgccctcatccctagcataaagtgtactggtccttta
gcgaattctatttcagagaaaacaagagaccaagtagacgaagatgatgaatacaaggtt
ccttcatcccatcccgtttccctgaactcacagccgtctcattgtcataatgtaaaacct
cctattaggtcttgtgataatggtcattgtatattgaatggaacacatggtacctcttca
gagatgaagaaatcaaacatccctgaactaggcatatatttaaagggagatgtttttgat
tcagcctctgatccagtgccattgccacctgccaggcctccaactcgggacaatccaaag
catggttcttcactcaacaggacgccctctgattatgatcttctcatccctccattaggc
gaagatgcttttgatgccctccctccatccctcccgcctcccccacctcctgcaaggcat
agtgtcatcgaacattcaaaacctcctggctccggtagccgaccatcctcaggacaagac
cttttccttcttccttcagatcccttttttgatccagcaagtggccaagttcctctgccc
cctgctaggagattaccaggtgaaaatgtcaaatccaacaggacctcgcaggactatgat
cagctcccttcatgtccagatggttcacaagcaccagccagaccccctaaaccacgaccc
cgcaggactgcaccagaaattcaccacagaaaaccccatgggcctgaggcagcattggaa
aatgtggatgcaaaaattgcaaaactcatgggagaggggtatgcctttgaagaggtgaag
agagccttagaaatagcccagaataatgtcgaagtggctcgtagcatccttcgagaattt
gccttcccccctccagtctccccacgtctcaatctatag

DBGET integrated database retrieval system