KEGG   Loxodonta africana (African savanna elephant): 100658893
Entry
100658893         CDS       T04351                                 

Gene name
SCN4B
Definition
(RefSeq) sodium channel subunit beta-4 isoform X2
  KO
K04848  voltage-gated sodium channel type IV beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100658893 (SCN4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100658893 (SCN4B)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   100658893 (SCN4B)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Glycophorin_A Syndecan Ig_2 Marek_A
Other DBs
NCBI-GeneID: 100658893
NCBI-ProteinID: XP_003418358
UniProt: G3T3C4
LinkDB
Position
Unknown
AA seq 228 aa
MPGAGIRGEARARWLGTGLLGLFLLPVSLSLEVSVGKATTISAVNGTEILLPCTFSSCFG
FENLRFWWSYNSSDTFKILIEGTVKNEKSDPKVKSKDNDRITLEGSTKEKVNNISILLKD
LEFSDTGKYTCHVKNPKENYLQHQATIFLHVVEKLEEVDNTVTLIILAVVGGVVGLLIFI
LLLKKFITFILKKAQEKKKECLVSSSGNDNTENGLPGSKAGEKPPTKV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcccggggctgggatccgaggcgaagcccgggcgagatggctgggcactgggcttttg
ggtctcttcctgctccccgtgtccctgtcgctggaggtgtctgtgggaaaggccaccacc
atctccgctgtcaacggcaccgagatcctgctgccttgcaccttttccagctgctttggc
ttcgagaacctgcgcttctggtggtcctacaacagcagtgatactttcaagattctaata
gaagggactgtgaagaatgagaagtctgaccccaaggtgaagtcaaaagataatgaccgt
atcactctggagggttccaccaaggagaaggtgaacaacatttccattctgctgaaggac
ctggaatttagtgacaccggcaaatatacctgtcatgtgaagaaccccaaggagaactat
cttcagcaccaggccaccatcttcctccacgtcgttgagaaattggaggaagtggacaac
accgtgacactcatcatcctggccgttgtgggcggggtcgttgggctcctcatcttcatc
ctgctgctcaagaagttcatcacctttatcctcaaaaaggctcaggagaagaagaaggaa
tgcctcgtgagttcctcagggaatgataatacagagaatggattgcctggctccaaggca
ggagagaaaccacccacgaaagtgtga

KEGG   Loxodonta africana (African savanna elephant): 100672206
Entry
100672206         CDS       T04351                                 

Gene name
SCN7A
Definition
(RefSeq) sodium channel protein type 7 subunit alpha
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100672206 (SCN7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100672206 (SCN7A)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   100672206 (SCN7A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc IQ GPHH DUF2570
Other DBs
NCBI-GeneID: 100672206
NCBI-ProteinID: XP_003405861
LinkDB
Position
Unknown
AA seq 1688 aa
MVASAKLEMLTSPEPKGLVPFTKESLELMKERIAKKHSEDNEAEDLQPSIDLEVGRELPF
AYGNLSPGMVSAPLEDVDPYYKNKNTFIVLNKKRTVFRFNATSAWCTLSPFDCFRRTIIK
VLVHPFFRMLILISVLTDCIFMTMTNFADWRALLENALLGIYTFEILVKLIARGIWAGPF
SFIGDPWNWLDFSVTLFEFIIRYSLPGFASILNTARTLRILKTIPLNQGLKSLVGILNRC
VKKLIGVITLTLLFLSIFSLIGMGLFMGNLKHKCLRWPQENENKTLHNRTGNPHYIREVE
NFYYWEGERYALLCGNRTDASQCPEGYVCVKAGGNPDYGYTNFDNFGWAFFALFRLMTQD
YPEVLYHQILYASGKVYMIFFVVVSFWFAFYMASLFLSILAMAYEEEKQTNTEKAKKIEP
KYQQTLKEFQEGKEAAETKTIQIEMKKRSPASMSTSVDLLDDGTFAHKEEVKESRKKCPL
CWYRFAKTFLIWNCSPCWLKWKEFVHMIIMDPFTDLALAICIILNILFLALEHYPRSEGT
NSLLSIGNLVFIGIFTAEMILKIIAMHPHGYFQVGWNIFDSLIVFHGLAELYIVTVQGIA
LFQLFRMLRIFKLGKYWPTFTNLMWTLGNSLLALKNLILLLFTFSFFSAVLGLKIFGVNY
ENCVCNIDKGCQLPRWHMHDFFHSYLNVFRILCGEWIETLWDCLEVASRVTCIPFYMMVI
LIGNLLIFYLFLALVSSFSSYKSATIEENNEAKNLRLAMARIKKGINSMLLKTLCKKQNA
PKETMENVNDMHVKETLSDNTLFELSDTQDFFKEKEKSSGMEKHTMTENESQSLIPSPSV
SETVPIASGESDIENLDNKEIQSKSGDGSSKEKLKQSSSSECSTVDIATSEEEMIYEREK
PKHLKNGKRKIRSSPGQISRESKKGKIWQNVRKTCCKIVENSWFKCFIGLVTLLSTATLA
FEDIYINQRKTIKILLEYADMIFTYIFILEILLKWMAYGFKAYFTNAWYRLDFVVVIVFC
LSLIGKFREDLKPLISIKFLRALRVLSQFERMKVVVRALIKTTLPTANVFLVCLMIWLVF
SIMGVHLFAGKFYECIDPTSGERFPVSEVMNKSQCESLVFNESMPWENAKLNFDNVGNGF
LSLLQVATFNGWITIMNSAVDSIAVNMQPNFEDNIYMYCYFINFIIFGLFLPLSILTGAI
VANFKKHKLKQGGSNIFITVKQKKECRGLKKFMSEDSQRPIPPPRNKLQGLIFVLVTNQI
FNITIMVLIFVHAITIMMKSDDESPQMKTVFYWINTVFVVLYTVECLLKLISFRCYYFTI
GWNIFDFVVVVFSITGLFLPAEYYLGSPSLVQLILLSRIIHILRLGKGPKVFHNLLLPLM
LSLPALMNLCLLIFLVMFVYAILGMYNFAYVKKEAGINDVSNFETFGSSMLCIFQVTIFA
GWDGMLSAIFNSEWSDCDPDKINPGTQVKGDCSNPYFGIIYFVSYILISWLIIVNMYIVV
VMEFFNIVSKKKAKTLSEDDFRKFFQVWKRFDPDKTQYIDSSKLSDFAAALDPPLLMAKP
NKGQLVAMDLPMAVGDRIHCLDILLAFTKRVLGKDERMEKVISEIETGFILANPFKITYE
PITTTLKRKQEAVSATIIQRAYKSYRLRRNYKNTSDIHMIDDGGSVKATKEDIHFDKAKE
KSIIQSQV
NT seq 5067 nt   +upstreamnt  +downstreamnt
atggtagcaagtgcaaaattggaaatgctgacttccccagaacctaagggccttgtccct
ttcaccaaagagtcacttgaacttatgaaagagcgtattgctaaaaaacacagtgaggac
aatgaagcagaagacttacagccaagcattgacttggaagttggcagagagcttccattt
gcttatggcaacctttctccaggaatggtgtcagcacccttggaagatgtggacccatac
tacaaaaataaaaatacgttcatagtattaaataaaaagagaacagtcttcagattcaat
gccacttctgcttggtgtactttgtcaccttttgattgttttagaagaacaattattaag
gttttggtacatccctttttccgaatgttgattttaattagtgtcctgactgactgcata
tttatgaccatgactaattttgcagattggagagcattattagagaacgctttgcttgga
atttacacgtttgaaatacttgtaaaactcattgcaagaggcatctgggcaggacctttt
tctttcattggtgatccatggaactggcttgatttcagtgtcactttgtttgagtttata
ataagatattcacttccaggctttgcttcaatacttaatactgcaagaactttgaggatt
ttgaaaactatacctttaaatcaaggtctaaagtctcttgtagggatcctaaaccgctgc
gtgaagaaacttattggtgtcattacccttactctgctttttctgagcatattttctcta
attgggatgggactcttcatgggcaacctgaagcataaatgtttgcggtggccccaagaa
aatgaaaataaaacactacacaacagaactggaaacccacattatattcgagaagtagaa
aacttttattattgggaaggagaaagatacgctctcctttgtggcaacagaacagatgct
agtcagtgtcctgaaggctacgtatgtgtaaaagctggtggaaaccctgactatggctac
acaaattttgacaattttggctgggccttctttgccctgtttcggttaatgactcaggac
tatccagaggtactttatcaccagatcctttatgcctctgggaaggtctacatgatattt
tttgttgtggtaagtttttggtttgccttttatatggcaagtctgttcttgagcatactt
gctatggcctatgaagaagaaaagcagacaaacactgaaaaagctaagaagattgaacca
aaatatcaacagaccttaaaagaatttcaagaaggaaaagaagcagctgagaccaagacc
atacaaatagaaatgaagaaaagatcaccagcttctatgagcacatctgtggatttgttg
gatgatggtacttttgcacataaagaagaagttaaagaatctaggaagaaatgtccattg
tgttggtatagatttgctaaaactttcttgatctggaattgttccccctgttggttaaaa
tggaaagaatttgtccatatgattataatggacccatttactgatcttgcccttgccata
tgcataattttaaacatactgtttttggcattggaacattatccaagaagtgaaggaacc
aacagtcttctcagtatcggaaacctggtttttattggaattttcacagcagaaatgatt
ttaaaaataattgccatgcatccacatgggtatttccaagtaggttggaacatatttgat
agcctaattgtgttccatggtttggctgaactttatatagtgactgtgcaaggaatagct
ctttttcaattattcaggatgctgcgaattttcaagctgggaaaatattggccgacattt
acaaatctaatgtggactcttggtaactcattgttggccctgaaaaacttgatcctccta
ctgtttacgttcagcttcttctctgctgtgcttgggctgaagatctttggtgtgaattac
gaaaactgtgtttgcaatatagacaaaggctgccaactcccacgctggcacatgcatgac
ttcttccactcctacctgaatgtgttccggattctctgtggagaatggatagagacctta
tgggactgcttggaggtggcaagccgagtcacatgtattcccttttacatgatggttatt
ttaattggaaacttattgatattttacctgtttttggctttggtgagctcatttagttca
tacaagtctgcgacaattgaagagaacaatgaagcaaaaaatcttcggcttgccatggca
aggattaaaaaaggaataaactccatgcttttaaaaacattgtgcaaaaaacaaaatgct
ccaaaggagacaatggaaaatgtcaatgacatgcatgtcaaagagactctttctgacaat
accctttttgaattgagcgacacccaagatttcttcaaggagaaagaaaaaagcagtggc
atggagaaacacacaatgactgaaaatgagagtcaatcacttattcccagtcctagtgtc
tcagaaactgtcccaattgcttcaggggaatctgatatcgaaaatctggataataaggaa
attcagagcaagtcgggtgatggaagcagcaaagagaaactaaagcaatctagctcatca
gaatgcagtacagtcgatattgctacttctgaagaagaaatgatctatgaacgtgagaag
ccaaagcatcttaaaaatggtaagagaaaaataagatcttcacctggtcaaatcagtaga
gagtccaagaaaggaaaaatttggcagaacgtaaggaaaacttgctgcaagatagtagaa
aacagttggtttaagtgttttattggcctagtcactcttctcagcacagccactctggct
tttgaagatatatatatcaatcagagaaagactattaagatcttattagaatatgctgac
atgatcttcacttatatcttcattctggaaattcttctaaagtggatggcatacggcttt
aaagcctatttcactaatgcctggtacaggctggacttcgtggttgttattgtcttttgt
cttagcttaataggcaaatttcgagaagatctaaaaccacttatatctattaaattcctt
cgggcactcagagttctatctcaatttgaaagaatgaaggtggttgtgagagctttgata
aaaacaactttacccactgccaacgtgtttctggtgtgccttatgatctggctggttttt
agcattatgggagtacacttatttgctggcaaattctatgaatgcattgatccaacaagt
ggagaaaggtttcctgtatctgaagttatgaataagagtcagtgtgaaagtcttgtgttt
aatgaatccatgccatgggagaatgcaaaactgaactttgataatgttggaaacggtttc
ctttcactgcttcaagttgcaacatttaatggctggatcactattatgaattcagcagtt
gattctattgctgtaaatatgcagcctaattttgaagacaacatctatatgtattgttac
ttcatcaactttattatctttggactatttcttcctctgagtatactgactggtgctatt
gttgccaatttcaaaaagcataaattaaagcagggaggctcaaatatctttataacagta
aaacagaagaaagagtgccgtggattgaagaagttcatgtctgaggactctcaaagaccg
atacctcccccaagaaacaagctccaaggactcatctttgtcttggtgactaatcaaatt
tttaatatcaccatcatggttcttatctttgtccacgcgataacaattatgatgaaaagt
gatgatgagagtccacaaatgaaaactgttttctactggattaacacagtttttgttgtg
ctatatactgtagaatgcttgctgaagctcatctctttccgctgttactatttcaccatt
ggatggaacatttttgattttgtggtggttgttttctccattacaggactatttctacct
gcagaatactaccttggatctccttccctcgtccaactgatacttctgtctcggattatc
cacatcctgcgtcttgggaaaggaccaaaagtgttccataatctgctgcttcctttgatg
ctgtccctcccagcattgatgaacctctgtcttcttatcttcctggtcatgtttgtttat
gccatcttaggaatgtacaattttgcctatgttaaaaaagaagctggaatcaatgatgtg
tccaactttgaaacctttgggagcagcatgctgtgcatttttcaagttaccatatttgct
ggttgggatgggatgcttagtgcaattttcaacagtgaatggtctgactgtgatcctgat
aaaatcaaccctgggactcaggttaaaggagattgcagtaacccctattttgggattatt
tattttgtcagttacatcctcatctcatggctgatcattgtaaatatgtacattgttgtt
gtcatggagtttttcaatattgtttcaaaaaaaaaagccaagaccttgagtgaagatgat
tttaggaagttttttcaagtatggaagaggtttgatcctgataagacccaatacatagac
tctagcaagctttcagattttgcagctgctcttgatcctcctcttctcatggcaaaacca
aacaagggccagctcgttgccatggatcttcccatggcagttggggaccgaattcactgt
cttgacatattgctcgcttttacaaagcgagttttgggtaaagatgagaggatggagaaa
gtcatttcagagatagaaactgggtttatattagccaacccttttaagatcacgtatgag
ccaattacaactactctaaaacgaaaacaagaggcagtctcagccactatcatccaacgt
gcttataaaagttaccgtttgaggcgaaattacaaaaatacatcagatattcacatgata
gatgatggtggaagtgttaaagctactaaagaagatatccactttgataaagctaaggaa
aagtcaattattcaaagccaagtctaa

KEGG   Loxodonta africana (African savanna elephant): 100674190
Entry
100674190         CDS       T04351                                 

Gene name
SCN1B
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium channel subunit beta-1
  KO
K04845  voltage-gated sodium channel type I beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100674190 (SCN1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100674190 (SCN1B)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   100674190 (SCN1B)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100674190
NCBI-ProteinID: XP_023395641
LinkDB
Position
Unknown
AA seq 186 aa
MTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKVDLRYENEVLQLEEDERFEGRVVW
NGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHLEVVDKANR
DMASIVSEIMMYVLIVVLTLWLGAEMVYCYKEDRCCHGGRWQENASEYLAITSESKENCT
GVQVAD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccttcaaaattctctgtatctcctgcaagcggcgcagcgagaccaacgccgagacc
ttcaccgagtggaccttccgccagaagggcactgaggagtttgtcaaggtggatctgcgc
tacgagaacgaggtcctgcagctggaggaggacgaacgctttgagggccgcgtggtatgg
aatggcagccggggcaccaaggacctgcaggacctgtccatcttcatcaccaacgtcacc
tacaaccactcgggcgactatgagtgccacgtctaccgcctgctcttctttgagaactac
gagcacaacaccagcgtcgtcaaaaagatccacctcgaggtggtggacaaagccaacaga
gacatggcgtccattgtgtccgagatcatgatgtacgtgctcattgtggtgttgacctta
tggctcggggcagagatggtttactgctacaaggaagatcgctgctgccacggaggccgc
tggcaggagaatgcctcggaatacctggccatcacctcagagagcaaagagaactgtacg
ggcgtccaggtggccgattag

DBGET integrated database retrieval system