KEGG   Loxodonta africana (African savanna elephant): 100658920
Entry
100658920         CDS       T04351                                 

Gene name
GABRB2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-2 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100658920 (GABRB2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100658920 (GABRB2)
   04726 Serotonergic synapse
    100658920 (GABRB2)
   04723 Retrograde endocannabinoid signaling
    100658920 (GABRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100658920 (GABRB2)
   05033 Nicotine addiction
    100658920 (GABRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100658920 (GABRB2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100658920 (GABRB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100658920
NCBI-ProteinID: XP_003404684
UniProt: G3TKG0
LinkDB
Position
Unknown
AA seq 474 aa
MRRVRKKGYFGIWPFPLIIAAVCAQSVDDPSNMSLVKETVDKLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLRR
NIGYFILQTYMPSILITILSWVSFWISYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFLALLEYALVNYIFFGRGPQCQKKAAEKAASVSSEKMRLDVSKM
DPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDAATIQYRKAGLPRHSFGRNALER
HVAQKKSHLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYIN
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcggagagtccggaaaaagggttactttgggatttggcccttccccttaataatcgcc
gctgtgtgtgctcagagtgtcgatgaccctagtaatatgtcgctggttaaagagacggtg
gataaactcctgaaaggctatgacattcgtctgcggccagattttggaggtccgcccgtg
gcggtgggtatgaacattgacatcgccagcatcgatatggtttccgaagtcaatatggat
tacaccctgacaatgtactttcagcaagcctggagagataagaggctgtcctacaatgta
atacctttaaacttgactctggacaatagagtggcagaccagctctgggtgcctgatacc
tacttcctgaacgataagaagtcatttgtgcatggagtgactgtcaagaaccgaatgatc
cgcctgcatccagatgggactgtcctttatggcctcaggatcacaactacagctgcctgc
atgatggacctaagacggtacccactggatgaacaaaactgcaccttggaaattgaaagc
tatggatacacaactgatgacattgagttttactggcgtggggatgataatgcagtaacc
ggagtgacaaagattgaacttccacagttctctatcgtagattacaaactcatcaccaag
aaggttgttttttccacaggttcctatcccaggttgtctctcagctttaagcttaggaga
aacatcggttactttatcctgcagacatacatgccttccatcctgatcaccatcctctcc
tgggtctccttctggattagttatgatgcttcagctgcaagagtggcattaggaatcaca
actgtcttgacaatgaccacgatcaacacccatctccgagaaactctccctaaaatcccc
tatgtgaaggccattgacatgtacctaatggggtgctttgtctttgttttcttggccctt
ctggaatatgctcttgttaactacatcttctttggaaggggaccacaatgccaaaagaaa
gcagctgagaaggctgctagcgtcagcagtgagaagatgcgcctggatgtcagcaagatg
gacccccatgagaacatcttactgagcacccttgagataaaaaatgaaatggccacatct
gaggctgtaatgggacttggagaccccaggagcacaatgctggcctacgatgccgctacc
atccagtaccggaaagcggggttgcccaggcatagttttggccgaaacgccctggaacga
catgtagcacaaaagaaaagccacctgcgcagacgcgcctcccaactgaaaatcaccatc
cccgacttgaccgatgtgaatgccattgatcggtggtctcgcatattcttcccagtggtt
ttttccttcttcaacatcgtctattggctttattatataaactaa

KEGG   Loxodonta africana (African savanna elephant): 100659390
Entry
100659390         CDS       T04351                                 

Gene name
GABRA6
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-6
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659390 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100659390 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    100659390 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    100659390 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100659390 (GABRA6)
   05033 Nicotine addiction
    100659390 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659390 (GABRA6)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100659390 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 100659390
NCBI-ProteinID: XP_003404686
UniProt: G3THV6
LinkDB
Position
Unknown
AA seq 453 aa
MASPLPWLYFILWLDTTLGNLKEEGNLYSQNISRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIQSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQEAKRNAQIAAPPPVTISKAKEPLEAKI
VLHPDSKYHLKKRITSLTLPIVPSSESSKVLTRVPILQPTPLTPPPLSPDFGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDTMEVSGSVE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcatcgcctctgccctggctctactttattctatggctagataccactctggggaat
ctcaaagaagaaggaaacctatactcacagaacatcagccggatcctggacaatctgctt
gaaggctacgataatagactgcgaccgggatttggtggtgctgtcaccgaagtcaaaaca
gacatttatgtgaccagttttgggccagtgtcagatgtggagatggagtatacaatggat
gttttctttcgccaaacttggactgatgagaggttgaagtttgggggaccaactgagatt
ctaagtttgaataacttgatggtcagtaaaatctggacacctgacacttttttcaggaat
ggtaaaaagtccattgctcataacatgacaacgcctaataagctcttcagaatcatgcag
aacggaaccattctgtataccatgaggcttactatcaatgctgactgtcccatgaggctg
gttaactttcctatggatgggcatgcttgtccactcaagtttggcagctatgcttacccc
aaaagtgaaatcatatatacatggaaaaagggaccactttactctgtagaagtcccagaa
gaatcttcaagcctcctccagtatgatctgattggacaaacagtatctagtgagacaatt
caatctaatactggtgaatacgtaataatgacagtttatttccacttgcaaagaaagatg
ggctacttcatgatacagatatatactccgtgcattatgacggtcattctttcccaggtg
tctttctggattaataaagagtctgtcccggcaagaactgtctttgggatcaccactgtt
ttaaccatgaccactctgagcatcagtgccaggcactccttgccaaaagtgtcgtatgca
actgccatggattggttcatagctgtttgctttgcttttgtcttctctgctctgattgag
ttcgccgctgtcaactacttcaccaatcttcagacccaggaggccaagaggaatgcacag
attgcagccccaccaccagtgacgatatcaaaagcaaaggaacccttggaagctaagatt
gttttgcatccggattccaagtaccatctgaagaaaaggatcacttctcttaccttgcca
atagttccgtcttctgagtccagcaaagtccttactagagtacccatcttacaacctaca
cctcttacacccccaccactctctccagactttgggggcaccagtaaaattgaccagtat
tctcgaattctcttcccagttgcatttgcaggattcaaccttgtatactggatagtttat
ctttccaaagacactatggaagtgagtggcagcgttgaatag

KEGG   Loxodonta africana (African savanna elephant): 100659678
Entry
100659678         CDS       T04351                                 

Gene name
GABRA1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659678 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100659678 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    100659678 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    100659678 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100659678 (GABRA1)
   05033 Nicotine addiction
    100659678 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659678 (GABRA1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100659678 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100659678
NCBI-ProteinID: XP_003404687
UniProt: G3T055
LinkDB
Position
Unknown
AA seq 456 aa
MKRSPGLSDYLWAWTLLLSALTGGSFGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYQWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagagaagtccgggtctctctgactatctttgggcctggaccctccttctgagtgca
ttgactggaggaagttttggacagccctcattacaagatgaacttaaagacaataccact
gtcttcaccagaattttggaccgactccttgatggttacgacaatcgcctgagaccgggt
ttgggagagcgtgtaactgaagtgaagactgacatcttcgtcaccagtttcggacccgtt
tcagaccatgatatggaatatactatagatgtatttttccgtcaaagctggaaggatgaa
aggttaaaatttaaaggacccatgacagttcttcggttgaataacctaatggcaagtaaa
atctggactccagacaccttttttcacaatggaaagaagtcagtggcccataacatgacc
atgcccaacaaactcctgcggattacagaggatggaacgttgttgtataccatgaggctg
acggtgagagctgaatgtccaatgcacttggaagacttccctatggatgcccatgcctgc
ccactaaaatttggaagctatgcttatacgagagcagaagttgtttatcagtggaccaga
gagccagcacgctcagtagttgtagcggaagatgggtcacgcctcaaccagtatgatctt
cttgggcaaacagtagactctgggattgttcagtccagtacaggagaatatgttgttatg
accactcacttccatttgaagagaaagattggctattttgttattcaaacatacctgcca
tgcataatgacagttattctgtcccaagtctccttctggctcaacagagagtctgtacca
gcgagaactgtctttggagtaacaactgtgctgactatgacaacgttgagtatcagtgcc
agaaattctctccctaaggtggcttatgccacagcaatggattggttcattgcagtgtgc
tatgcctttgtgttctcagcgctgattgagtttgccacagtaaactatttcaccaagaga
ggctatgcttgggatggcaaaagtgtggttccagaaaagccaaagaaagtgaaagatcct
ctcattaagaaaaacaacacttatgctccaactgcaaccagctacacccctaatttggcc
cggggtgaccctggcttagccaccattgctaaaagtgcaaccatagaaccgaaagaagtc
aagccagaaacaaaaccaccagaacccaagaaaacctttaacagtgtcagcaaaattgat
cgactgtcaagaatagccttcccactgctatttggaatctttaacttagtttattgggct
acatatttaaacagagagcctcagctaaaagcccctactccacatcaatag

KEGG   Loxodonta africana (African savanna elephant): 100659961
Entry
100659961         CDS       T04351                                 

Gene name
GABRG2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-2 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659961 (GABRG2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100659961 (GABRG2)
   04723 Retrograde endocannabinoid signaling
    100659961 (GABRG2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100659961 (GABRG2)
   05033 Nicotine addiction
    100659961 (GABRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659961 (GABRG2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100659961 (GABRG2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100659961
NCBI-ProteinID: XP_003404688
LinkDB
Position
Unknown
AA seq 475 aa
MSSPNIWSTRSPVYSTPVFSQKMTVWILLLLSLYPGLTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagttcgccaaatatatggagcacaagaagcccagtctactcgactcctgtattttcc
cagaaaatgacggtgtggattctgctcctgctatcgctctacccaggcctcactagccaa
aaatctgatgatgactatgaagattatgcttctaataaaacatgggtcttgacacccaaa
gttcctgagggtgatgtcaccgtcattttaaacaacctactggaaggatatgacaataaa
cttcgacctgatataggagtgaaaccaacattaattcacacagacatgtatgtgaatagc
attggtccagtgaatgctatcaacatggagtacacaattgatatattttttgcccaaaca
tggtatgacagacgtctgaaatttaacagcaccattaaagtcctccgattaaacagcaac
atggtggggaaaatctggattccagacactttcttcagaaattcaaaaaaggctgatgca
cactggataaccacccccaataggatgttgagaatttggaatgacggccgagtcctctac
actctaaggttgacaattgatgctgagtgccaactacagttgcacaacttcccaatggat
gaacactcttgccccctggagttctctagttatggctatcctcgtgaagaaattgtctat
caatggaagcgcagctctgttgaagtgggcgacacaagatcttggaggctttatcagttt
tcatttgttggactgagaaataccactgaggtagtgaagacgacttctggagattatgtg
gtcatgtctgtctactttgacctgagcagaagaatgggatacttcaccatccagacctat
attccctgcacactcatcgttgtcctatcttgggtgtctttctggatcaataaggatgct
gttccagcaagaacatctctaggtatcaccactgtcttgacgatgaccaccctcagcacc
attgccaggaaatcactccccaaggtctcctatgtcacagcgatggatctctttgtatct
gtttgcttcatctttgtcttctctgctttggtggagtatggcaccctgcattattttgtt
agcaaccggaaaccaagcaaggacaaagacaaaaagaagaaaaaccctcttcttcggatg
ttttccttcaaggcccctaccattgatatccgcccacgatcggcaaccattcaaatgaac
aatgccacacatcttcaagagagagatgaagaatacgggtatgagtgtctggatggcaag
gactgtgccagttttttctgctgttttgaagactgccgaacaggggcttggagacacggg
aggatacatatccgtattgccaaaatggactcatatgctcggatcttcttccccacggcc
ttctgcttgttcaatctggtttactgggtctcctacctttacctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100662142
Entry
100662142         CDS       T04351                                 

Gene name
GABRB3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-3 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662142 (GABRB3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100662142 (GABRB3)
   04726 Serotonergic synapse
    100662142 (GABRB3)
   04723 Retrograde endocannabinoid signaling
    100662142 (GABRB3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100662142 (GABRB3)
   05033 Nicotine addiction
    100662142 (GABRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100662142 (GABRB3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100662142 (GABRB3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 100662142
NCBI-ProteinID: XP_010598504
LinkDB
Position
Unknown
AA seq 440 aa
MSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWR
DKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGL
RITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSI
VEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASA
ARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG
RGPQRQKKLAEKTAKAKNDRSKSEGNRVDAHGNILLTSLEVHNEMNEVTGGVGDTRNSAI
SFDNSGIQYRKQSVPREGHGRHMGDRSIPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSR
IVFPFTFSLFNLVYWLYYVN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcctttgtgaaggagacggtggacaagctgttgaaaggctacgacattcgcctaaga
cccgacttcggaggtcctccggtctgcgtgggaatgaacatcgacatcgccagcatcgac
atggtttctgaagtcaacatggactacaccttaaccatgtatttccaacaatattggaga
gacaagaggcttgcctattcggggatccctctcaacctcacattggacaatcgagtggct
gaccagctctgggtgcctgacacatactttttaaatgacaaaaagtcatttgtgcatggg
gtgacggtgaagaaccgcatgatccgcctacaccccgacgggacagtgctctacgggctc
agaatcacgactacagcagcatgcatgatggacctaaggaggtacccgctggacgagcag
aattgcactctggagatcgaaagttatggctacaccacggatgacattgagttttactgg
agaggtggggacaaggctgtcaccggagtggaaaggatcgagctcccgcaattctccatc
gtggaacaccgcctcgtctcaagaaatgttgtctttgccacaggtgcctatcctcgactt
tcactgagctttcggttaaagagaaacattggatacttcatccttcagacttacatgccc
tctatactgatcacgattctatcctgggtgtccttctggatcaattatgatgcatctgct
gctagagttgccctcgggatcacaactgtgctgacaatgacgaccatcaacacgcacctt
cgggagacgttgcccaaaatcccctacgtcaaagccattgacatgtacctcatgggctgc
ttcgtctttgtgttcctggcccttctggagtatgcctttgtcaactacattttttttgga
agaggccctcagaggcagaagaagcttgcagaaaagacagccaaggcaaagaatgaccgt
tcaaagagtgagggcaaccgggtggatgctcatggaaatattctgttaacatcgttggag
gttcacaatgaaatgaacgaggtcacaggtggtgttggtgatactagaaattcagcaata
tcctttgacaactcaggaatccagtacaggaaacaaagcgtgcctcgcgaaggccatggg
cgacacatgggggacagaagcatcccgcacaagaagacccatctacggaggaggtcttca
cagctcaaaataaaaatccctgatctaaccgatgtgaatgccatagacagatggtccagg
atcgtgtttccattcactttttctcttttcaacttagtttactggctgtactatgttaac
tga

KEGG   Loxodonta africana (African savanna elephant): 100662419
Entry
100662419         CDS       T04351                                 

Gene name
GABRA5
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662419 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100662419 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    100662419 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    100662419 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100662419 (GABRA5)
   05033 Nicotine addiction
    100662419 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100662419 (GABRA5)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100662419 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N SCIMP
Other DBs
NCBI-GeneID: 100662419
NCBI-ProteinID: XP_023395460
LinkDB
Position
Unknown
AA seq 463 aa
MDNGMFSSFIMVKTFLLFCISMNFASHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLQFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNDTTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKASEAA
KIKKKERELILNKSTNAYTTGKMAHPPNIPKEQTPAGTSNASSASVKSPEEKTSESKKTY
NSVSKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAAFPK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggacaatggaatgttctctagctttatcatggtcaaaaccttccttctcttttgtatt
tccatgaactttgccagtcactttggcttttcacaaatgccaacaagttctgtcaaagat
gagaccaatgacaatatcaccatatttaccaggatcttggatgggcttttggatggctat
gacaaccgcctgcggcctggcctcggagagcgaatcactcaggtgaggaccgacatctac
gtcaccagctttggccccgtgtctgacacagaaatggaatataccatagatgtgtttttc
cgacaaagctggaaagatgaaagacttcagttcaaagggccaatgcagcgtctccctctc
aacaaccttctcgccagcaaaatctggaccccagacacattcttccacaatgggaagaag
tccattgcgcacaacatgacaacgcccaacaagttgctgcggctggaggacgatggcacg
ctgctctacaccatgcgcttgaccatctctgctgagtgcccaatgcaacttgaagacttt
cccatggatgcccatgcatgccctctgaagtttggcagctatgcataccctaattccgaa
gttgtctacgtctggaccaatgacaccacgaagtctgtggtggtggcagaagatggctct
agactgaaccagtaccacctgatggggcagacggtgggtactgagaacatcagtaccagc
acaggtgaatacacaatcatgacagcacatttccacctgaagagaaaaattgggtacttc
gtcattcagacctaccttccctgcataatgaccgtgattttatcccaggtgtccttttgg
ctgaaccgggagtcggtcccagctagaacggtgtttggggtaaccacagtgctaacaatg
acgactctcagcatcagtgctcgaaactctctgcccaaagtggcttatgccacggccatg
gactggttcatagctgtgtgctacgcctttgtgttctccgccttgattgaatttgccact
gtcaactattttacaaagagaggttgggcctgggatggcaaaaaggcctcggaagctgcc
aagatcaagaaaaaggagcgtgaactcatactaaataaatcaacaaacgcttatacaact
gggaagatggcccaccccccaaacattccaaaggaacagaccccagcagggacctcgaat
gcatcttcagcctcagtaaaatctcccgaagagaagacttctgaaagcaaaaagacttac
aacagcgtcagcaagattgacaaaatgtcccgaattgtattcccagtactctttggcact
ttcaacttagtttactgggcaacatatttgaatagagagccagtgattaaaggagctgcc
tttccaaaataa

KEGG   Loxodonta africana (African savanna elephant): 100662697
Entry
100662697         CDS       T04351                                 

Gene name
GABRG3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-3
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662697 (GABRG3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100662697 (GABRG3)
   04723 Retrograde endocannabinoid signaling
    100662697 (GABRG3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100662697 (GABRG3)
   05033 Nicotine addiction
    100662697 (GABRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100662697 (GABRG3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100662697 (GABRG3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100662697
NCBI-ProteinID: XP_003420689
LinkDB
Position
Unknown
AA seq 466 aa
MAPKLLLLLCLFSGLRARSRKVEEDEYEDSSNQKWVLAPKSQDTDVTLILNKLLREYDKK
LRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDTRLRFNSTMKILTLNSN
MVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMD
EHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTETVTTSAGDYV
VMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLST
IARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKKTSLLHPDCS
KRIHERVNLQAPSNYSLLDMRPPPAAMITLNNSMYWQEFEDTCVYECLDGKDCQSFFCCY
EECKSGSWRKGRVHIDVLELDSYSRVFFPTSFLLFNLVYWIGYLYL
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggccccgaagctgctgctgctgctctgcctcttctcgggcttgcgcgcgcggtccaga
aaggtggaagaggatgaatatgaagactcatcaaatcaaaagtgggtcttggctccaaag
tcccaggacacagatgtgacacttattctcaacaagctgctaagagaatatgataaaaag
ttgagaccggatattggaataaagccgactgtaattgatgtcgacatttatgttaacagc
attgggcctgtgtcgtcgataaacatggaatatcaaattgatatattttttgctcagacc
tggacagacacccgccttcgatttaacagcacgatgaagatccttaccctaaatagcaac
atggtggggctgatatggatcccagataccatcttccgcaattctaagactgcagaggcc
cactggatcaccacacccaaccagctcctcagaatctggaatgatgggaaaatcctctac
actttaaggctcaccattaacgcagagtgccagctgcagctgcacaacttccccatggat
gagcactcatgcccactgattttctccagctatggctaccccaaagaagaaatgatttac
agatggaggaaaaattcagttgaggcagcggaccagaaatcatggcgcctttatcagttt
gacttcatgggcctcagaaacaccacagaaactgtgaccacatctgcaggtgattatgtt
gtcatgactatatattttgaactgagtagaagaatgggatacttcactattcagacttac
attccctgtatactgacagtggtgctatcctgggtatctttttggatcaaaaaagatgct
acgccagcaagaacagcattaggcatcaccacagtactgaccatgaccaccctcagcacc
atagcgaggaagtccttgccccgagtgtcctacgtgaccgccatggacctctttgtgact
gtgtgcttcttatttgtctttgctgctctgatggagtatgccactcttaactactattcc
agttgtagaaaaccaaccaccactaagaagaaaacatctttattgcatccagattgctca
aaacggattcatgagcgagttaacctacaagccccctccaactactctctcctggatatg
aggccacccccagctgccatgatcactttgaacaattccatgtactggcaggagtttgaa
gacacttgtgtctatgagtgtctggacggcaaagactgccagagcttcttctgctgctat
gaagaatgtaaatcaggatcctggagaaaagggcgtgttcacatagacgtcttggagctg
gactcgtattccagggtcttcttccctacgtcgttcctgctctttaacctggtctattgg
atcggatacctgtatctctaa

KEGG   Loxodonta africana (African savanna elephant): 100663560
Entry
100663560         CDS       T04351                                 

Gene name
GABRP
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit pi
  KO
K05189  gamma-aminobutyric acid receptor subunit pi
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100663560 (GABRP)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100663560 (GABRP)
   04723 Retrograde endocannabinoid signaling
    100663560 (GABRP)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100663560 (GABRP)
   05033 Nicotine addiction
    100663560 (GABRP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663560 (GABRP)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100663560 (GABRP)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100663560
NCBI-ProteinID: XP_003404701
UniProt: G3THN1
LinkDB
Position
Unknown
AA seq 486 aa
MTGDSQGREAGLDLGEPFGCSASHLAPSLFPGDSYFDPALGEELLNMNYNLCLIFMCLSL
CTQRMCVQGNQFNIEVGRSDKLSLPGFDNLTAGYNKFLRPNFGGEPVQIALTLDIASISS
ISESNMDYTATIYLRQRWTDLRLVFEGNKSFTLDARLVEFLWVPDTYIVESKTSFLHEVT
VGNRLIRLFSNGTVLYALRITTTVGCNMDLSKYPMDTQTCKLQLESWGYDGNDVEFRWLR
GNDSVRGLENLRLAQYTIQRYFTLVTWSQQETGNYTRLVLQFELRRNVLYFILETYVPST
FLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICF
SFVFGALLEYAVAHYSSLQQMAAKDRGTAKEVEEVNITNVINSSISSFKRKISFANIEIS
SDKVNYSDLTMKTSDKFKFVFRDKMGKIIDCFTIQNPSNVDRYSKLLFPLIFMLANVFYW
AYYLYF
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgactggtgattcacaggggagagaggctggcctggacttaggtgagccttttgggtgt
tctgcctcccaccttgccccatctcttttcccaggtgattcctactttgaccctgccctg
ggtgaggagctcctcaacatgaactacaacctctgcttaatcttcatgtgcctaagtctc
tgcactcaaaggatgtgtgtccaggggaatcagtttaacatcgaggtcggcagaagtgac
aagctttccctgcctggctttgacaacctcacagcaggatataacaaattcctcaggcct
aattttggcggagaaccagttcagatagcactgactctcgacattgcaagcatttctagt
atttcagagagtaacatggactacacagccaccatatacctccgacagcgctggacggat
ttgcggctggtgtttgaaggcaacaagagcttcactctggacgcacgccttgtagagttt
ctctgggtccctgacacttacatcgtggaatccaagacctccttcctacatgaagtcact
gtgggaaacagactcattcgcctcttttccaatggcacggtcctgtatgctctcagaatc
acaacgactgttggatgtaacatggatctgtctaaataccccatggacacacagacatgc
aagttgcagctggaaagctgggggtatgatgggaacgacgtggagttcaggtggctgaga
gggaatgactctgtgcgtgggctggaaaacctgcggcttgctcagtacaccatacagcgg
tatttcaccttagtcacctggtcacagcaggagacaggaaattacacacgattagtcttg
caatttgagcttcgaaggaatgtcctgtatttcattttggaaacctatgttccctccact
tttctggtggtgttatcctgggtttcgttttggatctccctggattcagttcctgcaaga
acctgcattggtgtgaccactgtgttgtcaatgaccacactgatgatcgggtcccgcact
tctcttcccaacaccaactgcttcataaaggccatcgatgtgtacctggggatctgcttc
agcttcgtgtttggggccctactggaatatgcagttgcccactacagctccttacaacag
atggcagccaaagatagggggacagctaaggaagtggaagaagtcaatattactaacgtc
atcaacagctccatctccagctttaaacggaagatcagctttgccaacattgaaatctcc
agtgataaagtcaactatagcgacctgacaatgaaaaccagtgacaagttcaagtttgtc
ttcagagataaaatgggcaagattatcgactgtttcacaattcaaaaccccagcaatgtt
gatcggtattccaagcttttgtttcctttgatttttatgctggccaatgtattttattgg
gcatactacctgtatttttga

KEGG   Loxodonta africana (African savanna elephant): 100665222
Entry
100665222         CDS       T04351                                 

Gene name
GABRR3
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit rho-3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100665222 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100665222 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    100665222 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100665222 (GABRR3)
   05033 Nicotine addiction
    100665222 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100665222 (GABRR3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100665222 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100665222
NCBI-ProteinID: XP_010588745
LinkDB
Position
Unknown
AA seq 420 aa
MYKNSLDAETIRNFAVDVQETRMRNDDNTKVWPLKYMQLLHVEDHDFAMRPGFGGLPVPV
GIDVQVESIDSISEANMDFTMTFYLRSTKKMRGSFPSTTHKSMTFDHKKKKRLIKNIWVL
LSFFVYSKRPFIHDTTMENIMLXIHPDGNIPFNLRIIVSAMCSMDFSRFPLGTQNCGITL
RSGGYSEEDLMLYXKHGNQSLNTNDHFSFSQFFVEEFSASSGLTFYSSTGCYNRLFINFV
LRRHIFFFVLQTDFPAMLMVMISWVSFWVDRRTIPARVPLGITTVLTMSIIIMGVSASMH
QVSYVKATDMYMWVSSLFXYAAVNSLTTAEEWKQFRKTGKPFXHISGMYNIDAVQVMAFD
GCYHDNETSFSLHSAPEKEAHRQCQYRVILVNENKVPRRAHWSNHSGKHHVMDTYGFISH
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtataaaaactccctggatgcagagaccattagaaattttgctgttgatgtacaagaa
actagaatgcggaatgatgacaataccaaggtatggcccctgaaatacatgcaattgctg
cacgtagaggaccatgattttgcaatgagacctggatttggagggctcccagtgccagtg
ggaatagatgtccaggttgaaagtatagacagcatttcagaggctaacatggattttaca
atgactttttatctcaggtctactaaaaagatgagaggctcctttcctagcacaacacac
aaaagcatgacctttgaccataaaaaaaaaaaaagattgatcaaaaatatttgggtgctg
ttatctttttttgtctattctaaaaggcccttcattcatgatacaactatggagaacatt
atgctgntgatacaccctgatggaaacatccccttcaatctccgaataatagtttcagcc
atgtgctctatggattttagcaggtttcctcttggcactcaaaattgtggcatcacttta
aggtctggtggctacagtgaggaagatctaatgctgtactgaaaacatggaaaccagtcc
ctaaacaccaatgaccatttttccttttctcagttcttcgttgaggagttcagtgcatcc
agtggattgactttctatagcagcacaggttgttacaacaggcttttcatcaactttgtg
ctaagaaggcatattttcttctttgtgctgcaaactgatttcccagccatgttgatggtg
atgatttcatgggtttccttctgggttgaccgaagaactatccctgcaagagttcctttg
ggaattaccacagtgctgaccatgtccattatcattatgggtgtgagtgcctccatgcac
caggtgtcatatgtcaaggccacggacatgtacatgtgggtcagctccctcttcnngtat
gcagccgtgaattccctcaccacagcagaagagtggaaacaattcaggaagacagggaag
cctttttgacatatttctggaatgtataatattgatgcagttcaagtcatggcctttgac
gggtgttaccatgacaatgagacttccttttctctgcactctgctcctgagaaggaggcc
cacaggcagtgccagtacagagtcatcttggtgaatgagaacaaagttcctaggagggca
cactggtcgaatcattctggaaaacaccatgttatggacacctacggttttatttcccat
tag

KEGG   Loxodonta africana (African savanna elephant): 100665743
Entry
100665743         CDS       T04351                                 

Gene name
GABRA3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-3
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100665743 (GABRA3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100665743 (GABRA3)
   04723 Retrograde endocannabinoid signaling
    100665743 (GABRA3)
  09157 Sensory system
   04742 Taste transduction
    100665743 (GABRA3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100665743 (GABRA3)
   05033 Nicotine addiction
    100665743 (GABRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100665743 (GABRA3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100665743 (GABRA3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100665743
NCBI-ProteinID: XP_003421272
LinkDB
Position
Unknown
AA seq 492 aa
MILKQMSNFYVSSLGLLFLINIFPEATGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEVIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALDTKKKTPAAPTKKSSSTFNIVGTTYPINLAKDTEFSAISKAA
AASACSTPTIVASPKTTYVPETPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgatactcaaacaaatgagtaacttctacgtgagcagccttgggcttctcttcctgatc
aacattttcccagaagcaactggtcaaggtgaatcaagacgacaagaacctggggacttt
gtgaagcaggatattggcggactctctcctaaacatgccccagatattcctgatgacagc
actgacaacatcactatctttaccagaatcttagatcgtcttctggatggctatgacaac
cggctgcgacccggacttggagatgctgtgactgaagtcaagactgacatctatgtgacc
agttttggccccgtgtcagacactgacatggagtacaccattgatgtattctttcgacag
acatggcatgatgaaagactgaaatttgatggacccatgaagatcctaccactcaacaat
ctcctggctagtaagatctggactcctgacaccttcttccacaatggaaagaaatcagtg
gcccataacatgaccacgcctaacaagctgctcagactggtggacaatgggacccttctt
tacacaatgaggttaacaattcatgctgagtgccccatgcatttggaagattttcccatg
gatgtgcatgcctgtccactgaagtttggaagctatgcctatacaacagctgaagtagtt
tattcttggactcttgggaagaacaaatctgtggaagtggcacaggacggctctcgcctg
aaccagtatgacttgctgggccatgttgttgggacagaagtaatccggtctagtacagga
gaatatgtcgtcatgacaactcacttccatctcaagcgaaaaattggctactttgtgatc
cagacctacctgccctgtatcatgactgtcattctgtcacaggtgtctttctggctcaac
agggagtctgtccctgctcgcacggtctttggtgttacgactgtactcaccatgaccacc
ttgagtatcagtgccagaaattccttacctaaagtggcatatgcgacggccatggattgg
ttcatagccgtctgttatgcctttgtattttctgcactgattgaatttgccaccgtcaac
tacttcaccaagcggagttgggcttgggaaggcaagaaggtgccagaggccctggataca
aagaagaaaacaccagcagctccaacaaagaaaagcagcagcaccttcaacatcgtgggg
accacctatcctatcaacctggccaaggatactgagttctctgccatctccaaggctgct
gctgccagtgcctgttcaaccccaacaattgttgcttcacccaagaccacctatgtgcca
gaaacccccacagagaccaagacctacaacagtgtcagcaaggttgacaaaatttcccgc
attatctttcctgtgctctttgccatattcaatctggtctattgggcgacatacgtcaac
cgggagtcagctatcaagggcatgatccgcaaacagtag

KEGG   Loxodonta africana (African savanna elephant): 100666025
Entry
100666025         CDS       T04351                                 

Gene name
GABRQ
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit theta
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666025 (GABRQ)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100666025 (GABRQ)
   04723 Retrograde endocannabinoid signaling
    100666025 (GABRQ)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100666025 (GABRQ)
   05033 Nicotine addiction
    100666025 (GABRQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666025 (GABRQ)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100666025 (GABRQ)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb UPF0640
Other DBs
NCBI-GeneID: 100666025
NCBI-ProteinID: XP_003421273
LinkDB
Position
Unknown
AA seq 625 aa
MGIRGMLRAAVLLLLIRTWLAEGSAPNPTARFHFGRSTVPDVVQDLFNCKNCASEAVAHK
VLDRVLTGYDVRLRPNFGGDPVPVGISIYISSIEQISEINMDYTITMFFHQTWKDPRLAY
HETNLNLTLDYRMLNKLWVPDCYFLNSTDTFAHDVTVEKRVFQLQPDGTVRYGIRLTTTA
ACSLDLQKFPLDKQACKLEIESYGYTVEDVILFWEDDGNAIHGTEDLHVPQFSFLGKTIT
STEVYFYTGSYMRLILRFEVQREVSSFLVQVYWPTVLTTVLSWMSFWMNCDSAAARVTVG
LTSMLILTTISSHVRNKLPQVPCVKAIDIYIIVCFFFVFFSLMEYVYINYLFYSRGPRHH
HRRRRRARRVISRFRYWEVVVEEVQGDQISIEDDIDSLLSIPALARLASPESFSSLTSTP
ERARLATSESLSSLCSGSSQASGESLSQLSSTSAQALLFYGIMSEIRKRAEARERAEAGG
RGDLEENASLDESHGHSPGRLPLLNRGQRCVRQASWDLDDICSLLDDARVESGCPGLEEN
PEGDADSTWSLEEEGEEVLICVREEDSGSESDDSLPPSPGCSFSQGLSSKLFSPDYVPKV
DRWSRVLFPLAFGLFNIAYWAYHIN
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgggcatccgcggcatgctgcgggccgcggtgctcctgctgctcatccggacctggctg
gcggagggaagcgcccccaaccccaccgccaggttccacttcggccgctccaccgttcct
gacgtcgtccaggacctcttcaactgcaaaaactgtgcgagtgaagccgtggctcacaag
gttttggacagggtgctgacggggtacgatgtacgtctgagaccaaattttggaggtgac
cccgtgcccgtgggcatatccatctacatctccagtattgaacagatctcagaaattaat
atggactatacaatcacaatgttttttcatcagacctggaaagacccacgcttagcctac
cacgagaccaacctgaacctgactctagactatcggatgctcaacaagctgtgggtccct
gactgctacttcctgaatagcacggacacttttgcgcatgatgtgactgtggaaaagcgc
gtgtttcagcttcagcccgatggaacggtccggtatggcatccgactcaccaccacagca
gcttgttccctggacctgcagaaatttcctctggacaagcaggcctgcaagctggaaatt
gagagctatggctacacggttgaggacgtcatcttattctgggaagacgatgggaacgcc
atccacgggaccgaggatctgcacgtccctcagttcagcttcctggggaagacgattacc
agcacggaggtgtacttctacacaggctcttacatgcgcctgatcctgaggttcgaggtc
caaagggaagtcagcagcttccttgttcaggtctattggcccactgtcctcaccactgtt
ctctcctggatgtcgttttggatgaactgcgattccgctgctgccagggtaacagttggc
ttgacttcaatgctcatcctgaccaccatcagctcacatgtgcgcaataagctgccccaa
gttccctgtgtcaaggccatcgacatctatatcattgtgtgcttcttcttcgtcttcttt
tccttgatggagtacgtctacatcaactaccttttctacagccgaggacctcggcaccat
catagacgacgcaggcgagcccggagagttatcagtcgcttccgctactgggaagtggtg
gtggaagaagtgcagggagaccagattagtattgaagacgacatcgactctcttctctcc
atcccagcgctggcccgcctggcaagccctgagagcttcagctctttgacctccacccca
gagcgagcccggctggccacctcggaaagcctcagctccctctgctctgggtccagccag
gcttctggggaaagcctgagccagctctcctccacctcggcacaggccctgctgttctac
ggtattatgtctgagatccgcaagcgcgctgaggcccgtgaacgtgctgaggctggtggc
cggggagacctcgaggagaatgcaagcttggatgagagccatggccatagccctggcagg
ctgcctctgctcaaccgtggccagaggtgcgtgcgacaagcgagctgggacctggatgac
atctgtagcttgcttgatgatgcccgtgttgagagtggctgccctggccttgaggagaat
cctgagggtgatgctgacagcacctggagcctggaggaggagggggaggaagtcctgatc
tgtgtccgagaggaggacagtggctctgagtctgatgacagccttccccctagtccgggg
tgctccttcagccaagggctttcctctaagctctttagccctgactacgtccctaaggtt
gacaggtggtcccgcgtcctcttccctctggcctttgggctgttcaacattgcttactgg
gcataccatatcaactag

KEGG   Loxodonta africana (African savanna elephant): 100666363
Entry
100666363         CDS       T04351                                 

Gene name
GABRG1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666363 (GABRG1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100666363 (GABRG1)
   04723 Retrograde endocannabinoid signaling
    100666363 (GABRG1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100666363 (GABRG1)
   05033 Nicotine addiction
    100666363 (GABRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666363 (GABRG1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100666363 (GABRG1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100666363
NCBI-ProteinID: XP_003411374
UniProt: G3STH9
LinkDB
Position
Unknown
AA seq 465 aa
MGSWKAFFFSPFLLRSQSRGVRLMFLLLTLHLGNCVDKADDEDDEDLTANKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEISHTISGDYIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
KKGKTTRDRKLRNKASVPSGLHPGSTLIPMSSISLPQGEDDYGYQCLEGKDCASFFCCFE
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggttcgtggaaagcttttttcttctctccttttcttctgcggagtcaaagtagaggg
gtgaggctgatgttcttgttactgaccctgcacttgggaaactgtgttgataaagcagat
gatgaagatgatgaggatttaactgcaaacaaaacttgggtcttggcaccaaagattcac
gaaggagacatcacacaaattctcaactcattactccaaggctatgacaataaacttcgc
ccagatataggagtgaggccaacagtaattgaaacagatgtttatgtaaacagcattgga
ccagttgatcccataaacatggaatacacaatagatataatttttgcccaaacctggttt
gatagtcgtttaaaattcaatagtactatgaaagtgcttatgcttaacagcaatatggtt
gggaaaatttggattcctgacactttcttcagaaactcaagaaaatctgatgctcattgg
ataacaactcctaatcgtctgcttcgaatttggaatgatggacgagttctatatacccta
agattgacaattaatgcagaatgttaccttcagcttcataactttcctatggatgaacat
tcctgtccactggaattttcaagttatggataccctaaaaatgaaattgaatataaatgg
aaaaagccctctgtagaagtggccgatcctaaatactggcgattatatcaatttgcattt
gtagggttacggaactcaactgaaatctctcacacaatctctggggattatattatcatg
acaattttttttgacttgagcagacggatgggatattttactatccagacgtacattcca
tgtattctgacggttgttctttcttgggtgtctttttggattaataaagatgcggtacct
gcacgaacatcactgggtatcactacagttctgactatgacaaccctgagtacaatagcc
aggaagtctttacctaaagtttcctatgtgacagcgatggatctctttgtttctgtttgt
tttatttttgtttttgcagccttgatggaatatggaaccttacattattttaccagcaac
aaaaaaggaaagactacaagagacaggaagctcagaaacaaggcctcagtgccctctggt
ctccatcctggatccaccctgattccaatgagtagcatttctctgccacaaggagaagat
gactacggttatcagtgtctggagggcaaagattgtgccagcttcttctgttgctttgaa
gactgcagaacaggatcttggagggaaggaaggatacacatccgcattgccaaaattgac
tcctattctcgaatatttttcccaacagcttttgccctgtttaatctggtgtattgggtt
ggctatctttacttataa

KEGG   Loxodonta africana (African savanna elephant): 100666647
Entry
100666647         CDS       T04351                                 

Gene name
GABRA2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666647 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100666647 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    100666647 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    100666647 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100666647 (GABRA2)
   05033 Nicotine addiction
    100666647 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666647 (GABRA2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100666647 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5522
Other DBs
NCBI-GeneID: 100666647
NCBI-ProteinID: XP_023405626
LinkDB
Position
Unknown
AA seq 383 aa
MQFYVSFVFFVQGFTKMGMKTKWNIYNLQLLLLLLLVWDPARLVLANIQEDEAKNNITIF
TRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERL
KFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTV
QAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLG
QSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPAR
TVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGW
AWDGKSVVNDKVSENVLINKTIS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcaattttacgtatcttttgtttttttcgttcaaggctttacaaaaatgggaatgaag
acaaaatggaacatttacaacctgcagttgctgctcctgcttctcttggtgtgggatcca
gccaggttggtgctggctaacatccaagaagatgaggctaaaaataacattaccatcttt
acaagaattctagacagacttctggatggttacgataatcggcttagaccaggactggga
gacagcattactgaagtcttcactaacatctacgtgaccagttttggccctgtctcagat
acagatatggaatatacaatagatgttttctttcgacaaaaatggaaagatgaacggtta
aaatttaaaggtcctatgaacatccttcgacttaacaatttaatggctagcaaaatatgg
acaccagataccttctttcacaatgggaaaaaatcggtagctcataatatgacaatgccg
aataaactgcttcgaatacaggatgatgggactctgctatatacaatgcggcttacagta
caagctgaatgtccaatgcacttggaggattttccgatggatgcccattcatgtcctctg
aagtttggcagctatgcatatacaacctcagaggtcacctatatttggacttacaatgca
tctgattcagtacaagttgctcctgatggctccaggttaaatcagtatgatctcctgggc
caatcaattggaaaggagacaattaaatccagtacaggtgaatatactgtaatgacagct
catttccacttgaaaagaaagattgggtactttgtgattcagacgtatctgccttgcatc
atgactgtcattctctctcaagtgtcattctggcttaaccgagaatctgtgcctgcgaga
actgtgtttggagtaacaactgtgctaacaatgacaaccctaagcatcagtgctcggaat
tctctccccaaagtggcttatgcaacggccatggactggtttattgctgtttgctatgca
tttgtgttctctgccctaattgaatttgcaactgttaattacttcaccaaaagaggctgg
gcttgggatgggaagagtgtggtaaatgacaaggtaagtgagaatgttcttataaataag
acaatctcctaa

KEGG   Loxodonta africana (African savanna elephant): 100670099
Entry
100670099         CDS       T04351                                 

Gene name
GABRR2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670099 (GABRR2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100670099 (GABRR2)
   04723 Retrograde endocannabinoid signaling
    100670099 (GABRR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100670099 (GABRR2)
   05033 Nicotine addiction
    100670099 (GABRR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100670099 (GABRR2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100670099 (GABRR2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100670099
NCBI-ProteinID: XP_003404399
UniProt: G3SX97
LinkDB
Position
Unknown
AA seq 491 aa
MVKPGGICPSAGYYWKAACCITDIHKMPYFTRLILFLFCLVVLVESRKPRRRRWTGQLEM
PRPSHLYKKNLNVTKMRKGKPQPLLRVEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEV
DMDFTMTLYLRHYWKDERLAFPSTSNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTD
NIMLRVFPDGHVLYSMRITVTAMCNMDFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGD
ESLKTDEKISLSQFLIQKFHTTSRLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATL
MVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVF
VFLSVLEYAAVNYLTTVQEWKERKLQDKFPCTCGMLHSRTMMLDGSYSESEANSLAGYPR
SHILTEEERQDKIVVHLALSNESNSSRKKGLLKGQMGLCIFQNTHAIDKYSRMIFPASFI
FFNLIYWSVFS
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggttaagccaggggggatttgcccctccgcaggttactactggaaagcagcgtgttgc
atcacagacatccacaaaatgccttattttacaagactcattttattcttgttttgcttg
gtggttcttgtggaaagcagaaagcccaggaggaggagatggacagggcagctggaaatg
cccaggccaagtcacttatataagaagaacctcaatgtaaccaaaatgcgaaaaggaaaa
cctcagccgcttctccgagtggaagaccatgatttcaccatgaggcctgcctttggaggc
cctgccattccagtgggtgtggacgtgcaggtggagagcctagacagcatttctgaggtg
gacatggacttcaccatgaccctgtacctacggcattattggaaggatgagaggctggcc
tttcccagcaccagcaacaagagcatgaccttcgatggccggctggtaaagaagatctgg
gtccctgacgtcttctttgttcactccaaaaggtcattcacccatgatactaccactgac
aacatcatgctgagggtttttccagatggccatgtgctgtacagcatgaggattacggtc
accgctatgtgcaacatggacttcagccactttcccctggactcgcaaacctgctcattg
gagctggaaagctatgcatacacagatgaagatctgatgctgtattggaagaatggggac
gagtcgctgaaaacagatgagaagatctccctgtctcagtttctgatccagaagtttcac
accacttccagactggccttctacagcagcacgggctggtacaaccgtctgtacattaac
ttcactctgcgtcgccacatcttcttctttttgctccaaacctatttccctgccaccctg
atggtcatgctgtcctgggtatccttctggatcgaccggagagctgtgcctgctagagtt
tcactgggtatcaccacggtgctgaccatgtccaccatcattacgggtgtgaatgcctcc
atgccccgtgtctcctacatcaaggccgtggacatctacctctgggtcagcttcgtgttt
gtgttcctctcggtgctggagtatgcagctgtcaactacctgacaacggtgcaggagtgg
aaggaacggaagctgcaggataagttcccatgcacgtgtggaatgcttcactcaagaacc
atgatgctggatggaagctacagtgagtctgaggccaacagcctggctgggtacccaaga
agccatattttgacagaagaagaaaggcaagacaaaatagtggtccacctggccctgagc
aatgaatccaactcctccaggaagaaggggcttctgaagggccagatgggtctttgcata
ttccagaacactcatgccattgacaaatactccaggatgatattccctgcctccttcata
tttttcaatttaatttattggtcagtgttttcctag

KEGG   Loxodonta africana (African savanna elephant): 100670286
Entry
100670286         CDS       T04351                                 

Gene name
GABRE
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit epsilon
  KO
K05185  gamma-aminobutyric acid receptor subunit epsilon
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670286 (GABRE)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100670286 (GABRE)
   04723 Retrograde endocannabinoid signaling
    100670286 (GABRE)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100670286 (GABRE)
   05033 Nicotine addiction
    100670286 (GABRE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100670286 (GABRE)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100670286 (GABRE)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100670286
NCBI-ProteinID: XP_023396169
LinkDB
Position
Unknown
AA seq 585 aa
MDSTVPANSELSKSLRSFPSEVGSEGLGKKDGLTQLIVLNVSCSLFFSLNTPISHPTPPK
DGAETRPGGQRRSSFCWMPASGRRNLALSQGSSWGPTEGAADLHSLFVCSRVEGPQAKSE
KGASGDSDGFYGPKPQDPKKKPLTEGTKPPATGHRVARSPEASQILNTILSNYDHRLRPG
IGEKPTVVTVEFSVNSLGPLSTLDMEYNIDIIFCQTWYDERLRYNDSFETLVLNSNVVSQ
LWIPDTFFRNSKRTQEHTVTMPNQLIRIHRDGKVLYTIRMTIDAGCTLHMHRFPMDSHSC
PLSFSSFSYPVSEMTYKWEDFKLEINENNSWKLFQFDFKGMSNKTETLSTPAGDFMVMTF
FFNVSRKFGYVAFQNYVPSSVTTMLSWVSFWIKKDPAAARTSLGITSVVTMTTLCTFSRK
NFPRVSYVTALDFYLAICFVFCFCALMEFAVLNFLTYNQMKIRASPALPRARARARARAR
ARARARARAQKHQKALVHAIVNMEGSDGEGKSSNPGSSQRSKPVCCKWHSGFKKYYCTIP
NCEGSTWQQGHLCIHIYRLDYYSRVAFPLAFFFFSVLYWLGCLYF
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggatagcacagtgccggccaacagtgagctaagcaaatctttgcgctccttcccctct
gaagtgggttctgagggtctaggcaagaaagatggtttgacacagttaatagtcctgaat
gtgtcctgcagtcttttcttctccctgaacacccccatctctcaccccactccccccaag
gacggggctgagactcgcccgggcggccagcggagatcgtcattttgttggatgccagcc
tccgggagaaggaatcttgccttgtctcagggttccagctggggccctacggagggggca
gcggaccttcattctttgtttgtatgttctagggttgaaggaccccaggctaagtcagag
aagggagcctctggcgatagtgatggcttctatggccccaagccacaagaccccaaaaag
aagcccctcactgaaggaacaaagccccctgctactggccacagagttgccagaagccca
gaagcctctcagatcctgaacaccatattaagcaactatgaccacagactgcgccctggc
attggtgagaagccaactgtggtcactgtcgagttctcagtcaacagcctgggtcctctc
tctaccctggatatggaatacaacattgacatcatcttctgccagacctggtatgatgaa
cgtctccgttacaatgacagctttgaaacccttgttctgaacagcaacgtggtgagccag
ttatggatcccagataccttttttaggaattctaagaggactcaagagcacactgtcacc
atgccaaatcagttgattcgcatccacagggatggcaaggtgttgtacacaattaggatg
accattgatgctggatgtacactccatatgcacagatttccaatggattctcactcttgt
cctctgtctttctctagcttttcttatcctgtgagtgagatgacctacaaatgggaagat
ttcaagcttgaaatcaatgaaaacaactcctggaagctcttccagtttgattttaaagga
atgagcaacaaaactgaaactctgtcaaccccagctggtgatttcatggtcatgacattt
ttcttcaacgtcagcaggaagtttggctatgttgcctttcaaaactatgtcccttcttct
gtgaccacgatgctctcctgggtttccttttggatcaagaaggacccggcagctgctagg
acctctttaggaatcacctctgtagttaccatgaccacattgtgcaccttttcccgtaag
aatttcccacgtgtctcctatgtcacggccttggacttctatcttgccatctgctttgtc
ttctgcttctgtgcactgatggagtttgccgtgctcaactttctgacctacaaccagatg
aaaatccgtgcttctccagcacttccccgtgcgcgagcccgtgcgcgtgcgcgagcccgt
gcgcgtgcgcgagcccgtgcccgtgcccagaagcatcagaaagctcttgtccacgccatc
gtcaacatggagggaagtgatggagaggggaagtcctccaacccaggtagctcccagcgc
tcgaagcctgtctgctgcaagtggcacagtggtttcaagaaatactactgcaccatcccc
aactgcgaaggtagcacctggcagcagggccacctctgcatccacatctaccgcctggat
tactattcgcgggttgctttcccgctggccttcttcttcttcagtgtgctctattggctt
ggttgcctttacttttag

KEGG   Loxodonta africana (African savanna elephant): 100670389
Entry
100670389         CDS       T04351                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-1 isoform X2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670389 (GABRR1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100670389 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    100670389 (GABRR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100670389 (GABRR1)
   05033 Nicotine addiction
    100670389 (GABRR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100670389 (GABRR1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100670389 (GABRR1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100670389
NCBI-ProteinID: XP_003404400
UniProt: G3SX94
LinkDB
Position
Unknown
AA seq 479 aa
MVAVQDIKFGIFLLWWGWVLATESRVHWQEREGHEMAKKGRPQRQRQEAHEDAHHQGSPV
LKRSPDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAVPVGVDVQVESLDSISEVDMDFTM
TLYLRHYWKDERLSFPSTNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRV
QPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTD
ERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW
VSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVL
EYAAVNYLTTVQERKERKLQEKLPCACGLPQPRAVMLKGSYSDGEVNDLGSYMPENGEKP
DRMMVQLTLASERSSPQRKSRRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggtggctgtccaggatataaaatttggcatcttccttttgtggtggggttgggttttg
gccactgaaagccgagtgcactggcaagaacgagaaggacacgagatggctaagaaaggc
agacctcaaagacagagacaagaagcacatgaagatgcccaccatcaaggcagcccagtt
ctgaaacgaagccctgacatcaccaaatcacctctgacaaagtcagagcagcttctgagg
atagatgaccatgatttcagcatgagacctggctttggaggcccagccgttcccgttggc
gtggatgtgcaggtggagagcttggacagcatctcagaagttgacatggactttaccatg
accctctacctgaggcactactggaaggatgagaggctgtctttcccgagcaccaacaac
ctcagcatgacatttgacggacggctagtgaagaagatctgggttcccgacatgtttttc
gtgcactccaagcgctccttcatccacgacaccaccacagacaacgtcatgctgcgggtc
cagcccgacgggaaagtcctctacagtctcagggttacagtgactgcaatgtgcaacatg
gacttcagccggttccccctggacacccaaacgtgctcgctggaaattgaaagctatgcc
tacacggaagacgacctcatgctgtactggaaaaaaggcaacgattccttaaagacagat
gagcggatctcgctctcgcagttcctcattcaagaattccacaccaccactaaactggcc
ttttacagcagcacaggctggtacaaccgtctgtacattaacttcactctgcgtcgccac
atcttcttcttcttgctccaaacttatttccctgctactttgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagctgtgcctgccagagtccctttgggtatcaccacg
gtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatgccccgtgtctcctac
atcaaggctgtggacatctacctctgggtcagcttcgtgttcgtgttcctctcggtgctg
gagtatgcggccgtcaactacctgaccacagtgcaggagcggaaggagcggaaattgcag
gagaagctcccctgtgcctgtgggttaccccagccacgtgcggtgatgctgaaaggcagc
tacagtgacggggaggtgaatgacctgggaagctacatgcccgagaatggcgagaagcca
gacaggatgatggtgcagctgaccctggcctcagagaggagctccccccagaggaaaagt
cgaagaagcagctacgtgagcatgaggattgacacccacgccattgacaaatactccagg
ataatttttccagcagcatacattttattcaatttaatatattggtctattttctcataa

KEGG   Loxodonta africana (African savanna elephant): 100673112
Entry
100673112         CDS       T04351                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-4 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav04742  Taste transduction
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100673112 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100673112 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    100673112 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    100673112 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100673112 (GABRA4)
   05033 Nicotine addiction
    100673112 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673112 (GABRA4)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100673112 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100673112
NCBI-ProteinID: XP_003415908
UniProt: G3TNF3
LinkDB
Position
Unknown
AA seq 555 aa
MVSAKKVPAIAMSALVSFALLHLLCLAACLNESPGQNQKEEKLCPENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVNFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPLQ
EVPAVPVLRGRHPEAPLQSTDANLNMRKRTNALVHSESDVGNRTEVGNHPSRSSTVVQGS
SESTSKSYLASSPNPFSSANAAETISAARAHPPTPPSTLAGTGHAPQQASVGSASSHHVF
GSRLERIKTTVNSIGGSGKLSATTPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWV
VYLSKDTMEKSESLM
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggtttctgccaagaaggtgcccgcgatcgcgatgtccgccttggtcagtttcgccctc
ctgcacttgctgtgcctggcggcttgtttaaacgaatccccaggacagaaccaaaaggaa
gagaaattatgcccggaaaattttacccgcattctggacagtttactcgatggttatgac
aacaggctgcgccctggatttgggggtcctgttacagaagtcaaaactgacatatatgtt
accagctttggacctgtttctgatgttgaaatggaatacacaatggatgtcttcttcagg
cagacatggattgacaaaagactaaaatatgatggtcccattgaaattttgaggttgaac
aatatgatggtaacaaaagtgtggacccctgatactttcttcagaaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggcactatt
ttatacactatgagactcaccataagtgcggagtgtcccatgagattggtgaatttcccc
atggatggtcatgcatgtcctttgaaatttgggagttatgcatatccgaagagtgagatg
atctatacttggacaaaaggtcctgagaaatcagtagaagttccaaaggagtcttccagc
ttagttcagtatgacttgattggacaaacagtatcgagtgaaactatcaaatcaattacg
ggtgaatatattgtgatgacggtttatttccacctcagacggaagatgggttactttatg
attcagacatacatcccatgcattatgacagtcatactttctcaagtttcattctggata
aataaggaatcagttccagctaggactgtatttggaataaccacagtcctcaccatgacc
acattgagcatcagtgcaagacattctttgcccaaagtgtcctatgctactgccatggat
tggttcatagctgtttgctttgcttttgtattttcggccctcattgagtttgctgctgtc
aactattttaccaatattcaaatggaaaaggccaaaaggaagacatcaaaacccctccag
gaagttccagctgttccagtgctgagaggaaggcatccagaagcacctctgcagagcacg
gatgctaatttgaacatgagaaaaagaacaaatgctttggttcactctgaatctgatgtt
ggtaacagaactgaggtgggaaaccacccgagcagatcttccaccgttgtccagggatct
tctgaaagcacatcgaagtcttacttagcttccagtccaaatccattcagcagtgcaaat
gcagctgaaactatatctgcggcaagagctcatccgcccacccctccttccactcttgct
ggaactggacatgcaccccagcaagcatcagttggatctgcttcttctcaccacgtgttt
ggatcaagactggagcggattaagaccacagtaaatagcatagggggttcaggaaagtta
tcagccactactcctccctctgctccaccaccttctggctctggcacaagtaaaatagac
aaatatgcccgtattctctttccagtcacatttggggcatttaacatggtttattgggtt
gtttacttatctaaagacactatggagaaatcagaaagtctaatgtag

KEGG   Loxodonta africana (African savanna elephant): 100673796
Entry
100673796         CDS       T04351                                 

Gene name
GABRB1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-1 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100673796 (GABRB1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100673796 (GABRB1)
   04726 Serotonergic synapse
    100673796 (GABRB1)
   04723 Retrograde endocannabinoid signaling
    100673796 (GABRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100673796 (GABRB1)
   05033 Nicotine addiction
    100673796 (GABRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673796 (GABRB1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100673796 (GABRB1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 100673796
NCBI-ProteinID: XP_003415911
UniProt: G3UKU0
LinkDB
Position
Unknown
AA seq 474 aa
MWTVQNRESLGLLSFPVMIAMVCCAPHANEPSNMSYVKETVDKLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETTGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREAYGRALDR
HGVHSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggacagtacaaaaccgagagagtttggggcttctctctttccctgtgatgattgcc
atggtctgttgtgcaccacacgccaatgagcccagcaacatgtcatacgtgaaagagaca
gtggacaaattgctcaaaggatatgacattcgcttgcggccggactttggagggcccccg
gtggacgtcgggatgcggatcgatgtcgccagtatagacatggtctcggaagtgaacatg
gactatacactcaccatgtatttccagcagtcttggaaagacaaaagactttcttattct
ggaatcccactaaacctcacgctagacaacagggtagctgaccagctctgggtaccagac
acctactttctgaatgacaagaaatcatttgtgcatggggttacggtgaaaaaccgaatg
atccggctgcatccagatggaacagttctctatggactccggatcaccaccacggctgcg
tgcatgatggatctgcgaagataccctctggatgaacaaaactgcaccctggagattgaa
agctatggctatactactgatgacattgagttttactggaatggaggagagggagcagta
acaggagttaataaaattgagcttccacagttttcaattgtcgactacaagatggtatcc
aagaaggtggagttcacaacaggggcttatccacggctgtcactaagttttcgactaaag
aggaacattggttacttcattctgcaaacctacatgccttctacactgattacaattctg
tcctgggtgtctttttggatcaactatgatgcatctgcagccagagttgcactaggaatc
actacagtgctgacaatgacgaccataagcactcacctcagggagaccttgccaaagatc
ccatatgtcaaagcgattgatatttatctaatgggttgcttcgtgtttgtgttcctggct
ctgctggaatatgcctttgtaaattacatcttctttgggaagggccctcagaaaaaggga
gctagcaaacaagaccagagtgctaatgagaagaacaaattggagatgaataaagtccag
gttgacgcccacggcaacattctcctcagcaccttggaaatcaggaatgagacgaccggc
tcggaagtgctcaccggcgtgagcgaccccaaggccaccatgtactcctacgacagcgcc
agcatccagtaccgtaagcccctgagcagccgcgaggcctacgggcgcgccctggaccgg
catggcgtgcacagcaagggccgcatccgcaggcgcgcctcgcagctcaaagtcaaaatc
ccggacttgactgatgtgaactccatagacaagtggtcccggatgtttttccccatcact
ttctctctttttaacgtcgtttattggctttactatgtacactaa

KEGG   Loxodonta africana (African savanna elephant): 100676800
Entry
100676800         CDS       T04351                                 

Gene name
GABRD
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit delta
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676800 (GABRD)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100676800 (GABRD)
   04723 Retrograde endocannabinoid signaling
    100676800 (GABRD)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100676800 (GABRD)
   05033 Nicotine addiction
    100676800 (GABRD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100676800 (GABRD)
Ion channels [BR:lav04040]
 Ligand-gated channels
  GABA-A
   100676800 (GABRD)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100676800
NCBI-ProteinID: XP_010591476
UniProt: G3TH03
LinkDB
Position
Unknown
AA seq 449 aa
MATLAWLLPPLLLLCAQQQRGTRAVNDIGDYVGSNLEISWLPNLDGLVEGYARNFRPGIG
GPPVNVALALEVASIDHISEVNMEYTMTIFLHQSWRDSRLSYSHTNETLGLDSRFVDRLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSTRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSENQEQIHGLDKLQLAQFTITSFRFTTELMNFKSAGQFPRLSLR
FHLRRNRGVYIIQSYMPSILLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVKEQKAKIDVKNAI
VLFSLSAAGVNQGLAISNRQGRTPGNLMGSYRSAEVEMGETRRQEGPRSGGVRVLFKPID
ADTIDIYARAVFPAAFAAVNVIYWAAYTM
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggctacgctggcctggctgctgcctccgctcctgctgctctgcgcccagcagcaacgc
ggcaccagagccgtgaatgacattggcgattatgttggctccaacctggaaatctcctgg
ctccccaacctggatggcctggtggagggctatgcccggaacttccggcctggcatcggt
ggtccccccgtgaatgtggcgctcgcccttgaggtggccagcatcgatcacatctcagag
gtgaacatggagtacaccatgaccatattcctgcaccagagctggcgggacagcaggctc
tcctacagccacaccaacgagacgctgggtctggacagccgctttgtggaccgcctctgg
ctcccagacactttcattgtcaatgccaagtctgcctggttccatgatgtcaccgtggag
aacaagcttattcggctgcagcctgatggggtgatcctatacagcacccgaatcacctcc
acggtagcctgtgacatggacttggccaagtaccccatggatgagcaggagtgcatgctg
gatttggagagttatggctactcctctgaggacatcgtctactactggtcggagaaccag
gagcagatccatgggctggacaagctgcagctggcccagttcaccatcaccagtttccgc
ttcaccacagaactgatgaacttcaagtcagctgggcagttcccacgtctcagcctgcgt
ttccacctgcggaggaaccggggtgtctatatcatccagtcctacatgccgtccatcctc
ctggtcgccatgtcctgggtttccttctggattagccaggccgcagtgcccgccagggtg
tctctaggcatcaccacggtgctgacgatgaccacgcttatggtcagtgcccgctcctcc
ctccctcgggcctcagccatcaaagccctggacgtgtacttctggatctgctatgtcttc
gtgtttgctgccctggtggaatatgcctttgcacacttcaatgccgactaccggaagaag
cagaaggccaaggtcaaggtcaaggaacagaaggccaagatcgacgtgaagaatgccatc
gtgctgttctccctgtctgcggctggtgtcaaccaggggctggccatctccaatagacag
ggccgcacccccgggaaccttatgggctcttaccgctctgcggaggtagagatgggtgag
accaggaggcaagaggggccccgctcaggcggtgtgcgggtgctcttcaaacccatcgac
gcagacaccatcgacatatatgcccgcgctgtgttcccggcggccttcgcagcagtcaat
gtcatctactgggcggcctacaccatgtga

DBGET integrated database retrieval system