KEGG   Loxodonta africana (African savanna elephant): 100658952
Entry
100658952         CDS       T04351                                 

Gene name
ACTA2
Definition
(RefSeq) actin, aortic smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100658952 (ACTA2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100658952 (ACTA2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100658952 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100658952 (ACTA2)
   04147 Exosome [BR:lav04147]
    100658952 (ACTA2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100658952 (ACTA2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100658952 (ACTA2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100658952
NCBI-ProteinID: XP_003409293
UniProt: G3SMK8
LinkDB
Position
Unknown
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIG
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcactgccctggtgtgtgacaatggctctgggctctgtaag
gctggcttcgctggggacgatgctcccagggctgttttcccatccattgtgggccgtccc
agacatcagggggtgatggtgggaatgggtcaaaaagacagctacgtgggtgacgaagca
caaagcaaaagaggaatcctgaccttgaagtacccaatagaacatggcatcattaccaac
tgggacgacatggaaaagatctggcaccactctttctacaatgaacttcgtgttgcccct
gaagaacatccaaccctacttactgaagcgcccctgaatcccaaagccaatcgggagaaa
atgacccagatcatgtttgagaccttcaatgtcccagccatgtacgtagctattcaggct
gtgctgtccctctacgcctctggacgtacaactggcattgtgctagactctggggatggt
gtcacccacaacgtgcccatctacgagggctatgccctgccccacgccatcatgcgtctg
gacctggctggccgagatcttaccgactacctcatgaagatcctgactgagcgtggctat
tcctttgtgactactgctgagcgtgagattgtccgggacatcaaggagaaactgtgctac
gtagctctggacttcgaaaatgagatggccactgccgcatcctcctcctccctggagaag
agctatgagctgccagatgggcaggtgatcaccatcgggaatgagcgctttcgctgcccg
gagaccctgttccagccatccttcatcgggatggagtctgctggcatccatgaaaccacc
tacaacagtatcatgaagtgtgatattgacatccggaaggatctctatgctaacaacgtc
ctctcagggggcaccaccatgtaccctggcattgccgaccggatgcagaaggagatcacg
gccctagcgccaagcaccatgaagatcaagatcattgcccctccagagcgcaagtactct
gtctggatcggcggctccatcctggcttctctgtccactttccagcagatgtggatcggc
aaacaggagtacgacgaagccgggccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system