KEGG   Loxodonta africana (African savanna elephant): 100658990
Entry
100658990         CDS       T04351                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04020  Calcium signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04072  Phospholipase D signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04750  Inflammatory mediator regulation of TRP channels
lav04919  Thyroid hormone signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100658990 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100658990 (PLCG2)
   04014 Ras signaling pathway
    100658990 (PLCG2)
   04370 VEGF signaling pathway
    100658990 (PLCG2)
   04064 NF-kappa B signaling pathway
    100658990 (PLCG2)
   04066 HIF-1 signaling pathway
    100658990 (PLCG2)
   04020 Calcium signaling pathway
    100658990 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100658990 (PLCG2)
   04072 Phospholipase D signaling pathway
    100658990 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658990 (PLCG2)
   04613 Neutrophil extracellular trap formation
    100658990 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100658990 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100658990 (PLCG2)
   04662 B cell receptor signaling pathway
    100658990 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100658990 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100658990 (PLCG2)
   04670 Leukocyte transendothelial migration
    100658990 (PLCG2)
   04062 Chemokine signaling pathway
    100658990 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100658990 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100658990 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100658990 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100658990 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100658990 (PLCG2)
   04380 Osteoclast differentiation
    100658990 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658990 (PLCG2)
   05206 MicroRNAs in cancer
    100658990 (PLCG2)
   05205 Proteoglycans in cancer
    100658990 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100658990 (PLCG2)
   05214 Glioma
    100658990 (PLCG2)
   05223 Non-small cell lung cancer
    100658990 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100658990 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100658990 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100658990 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658990 (PLCG2)
   05169 Epstein-Barr virus infection
    100658990 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100658990 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658990 (PLCG2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100658990 (PLCG2)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100658990 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100658990 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 100658990
NCBI-ProteinID: XP_003418136
UniProt: G3SPA6
LinkDB
Position
Unknown
AA seq 1265 aa
MTTMVSVDTLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKSSKDFERAKTVRQKEDCCFTIFYGTQFVLSTLSLAADSKEDAV
KWLSGLKILHQEAMSASTPTVIESWLRKQIYSVDQTRRNSISLRELKTILPMVNFKVSSA
KLLKDKFVEIGAHRDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGSTDRPDASA
VHLHDFQRFLLHEQQEVWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVEMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRSLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEQHCSVEQQRYMAKV
FKEVLDDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEELPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAESGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLMFTSIYALIQHYRESHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRVPRDGAFLVRKREGADSYAITFRARSKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDVNSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGARIQQYFPSNYVEDISTVDVDELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPLRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPLPPEPQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgacgaccatggtcagcgtggacacccttccggagtatgagaagagtcagatcaagagg
gccctggagctggggacggtgatgaccgtgttcagcttccgcaagtccacgcctgagcgc
cggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagacggctgacaag
atcgagggctttttggatatcatggaaataaaggagatccgcccagggaaaagctccaag
gactttgagcgtgcaaaaacagtccgccagaaagaagactgctgcttcaccattttctat
ggcacccagtttgtcctcagcacactaagtttagcagcggactctaaggaggatgcagtt
aagtggctttcgggcttgaagatcttacaccaagaagcaatgagcgcctccacacccacg
gttattgagagttggctgagaaagcagatttattctgtggatcaaaccaggagaaacagc
atcagcctccgagagttgaagaccatcttgcccatggtcaactttaaagtgagcagtgcc
aagctcctcaaagataagtttgtggaaataggcgcgcacagagatgagctcagctttgaa
cagttccatctcttctataaaaaactcatgtttgaacagcaaaaatcgattcttgacgaa
ttcaagaaagattcttccgtcttcatcctggggagcaccgaccggccagatgcctccgct
gttcacctgcacgacttccagaggtttctcttacatgaacagcaggaggtttgggctcag
gatctaaacaaagtccgcgagcggatgaccaagtttattgatgacacaatgagggaaacg
gctgagcccttcttgtttgttgatgagttcctcacatacctgttctcacgagaaaacagt
atctgggatgagaagtatgatgtggtcgagatgcaggacatgaataaccccttgtctcac
tactggatctcctcttcacataacacgtatctcacgggtgaccagctgcggagcgagtcg
tccacggaggcatacgtccgctctctgcgaatgggctgtcgctgcattgagctggactgc
tgggatgggccagacgggaaacccattatctaccatggctggacgaggaccaccaagatc
aagtttgacgatgttgtgcaggccatcaaagaccacgcctttgtcacctcaagcttcccc
gtgatcctgtccattgagcagcactgcagtgtggagcagcagcgctacatggccaaggtg
ttcaaggaggtgctggatgacctgctgctcaccaagcccacggaggccagcgccgaccag
ctgccctcgcccagccagctgcgtgagaagatcattatcaagcataagaagctaggcccc
cgaggcgatgtggatgtcaacgtggaggacaagaaggatgagcacaagcaacagggtgaa
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgcgctattgctgat
gccaagctgtccttcagtgatgatattgagcagacagttgaagaggagctgccccaggac
acgccccccacagagctgcactttggggagaagtggttccacaaaaaggttgaaaagagg
accagtgccgagaagctgctgcaggagtactgtgctgagtcggggggcaaggacgggacc
ttcttggtgcgggagagtgagacctaccccaacgactacacgctgtccttctggcggtcg
ggccgggtccagcactgccgcatccggtccaccatggagggcgggaccctgaagtactac
ctgactgacaacctcatgttcaccagcatctatgccctcatccagcactaccgcgagagc
cacctgcgctgcgctgagttcgagctgcggctcaccgaccccgtgcccaaccccaacccg
cacgagtcgaagccgtggtactacgacagtctgagccgtggggaagcagaggacatgctg
atgagggtcccccgggacggggccttcctggtacggaagcgagaaggtgctgattcctac
gccatcaccttcagggccaggagcaaggtgaagcactgtcgcatcaaccgggacggccga
cactttgtgctggggacctcagcctacttcgagagcctggtggagctggtcagctactat
gagaagcacgcgctctaccgcaagatgaagctgcgctaccctgtgacccctgagctactg
gagcgctacaacatggaaagagatgtaaactccctctatgacgtcagcaggatgtatgtg
gatccaagtgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagcgacgagcttagcttctgccgtggtgctctcatccacaatgtctcc
aaggagcctgggggctggtggaaaggtgactatggggcccgaatccagcagtacttcccg
tcgaactatgtcgaggacatttcaacagttgacgtcgacgagctagaaaagcagatcatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaatacctataacgtc
gtgaaagccccacaagggaaaaaccagaagtctttcgtcttcatcctggagcccaagaag
cagggtgaccccccggtggagttcgccacagacagggtggaggagctctttgagtggttc
cagagcatccgagagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcaatcgccattgagctctctgatctggttgtctactgcaaaccaacc
agcaaaaccaaggataacttagaaaaccccgacttccgagaaatccgctccttcgtggag
accaaggcagacagcatcgtcagacagaagcccatcgatctcctgaagtacaaccagaag
ggcctgacccgtgtttaccccaagggacaaagggttgactcttcaaactatgaccctctt
cgcctctggctatgtggctcccagatggtggcgctcaacttccagacggcagataagtac
atgcagatgaatcacgccttattttccctcaatgggcgaacgggctacgtcctacagccc
gagagcatgaggaccgagaagtatgaccccctgccgcccgagccccagaggaagatcctg
atgactctgacagtcaaggttctcggcgcccgccatctccccaagctcggacgaagcatc
gcctgtccttttgtagaggtggaaatatgtggagccgagtatgacaacaacaagtttaag
acaacagttgtgaatgataatggcttaagtcctgtctgggcttcaacacaggagaaggtg
acgtttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtttacgaggaagat
atgttcagcgatcccaacttccttgctcatgctacttaccccattaagggaatcaaatca
ggatttagatcagttcctctcaagaacgggtacagtgaagacatagagctggcgtccctc
ctggttttctgtgaaatgcggcctgtcctggagagtgaagaggaactttactcctcctgt
cgccagctgcggaggcggcaagaagagctgaacaaccagctctttttgtatgacacacac
cagaacttacgcaacgccaaccgggacgccctggttaaggagttcaatgtcaatgagaac
cagctccagctgtaccaggagaagtgcaaccggaggttgagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Loxodonta africana (African savanna elephant): 100677739
Entry
100677739         CDS       T04351                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04072  Phospholipase D signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04613  Neutrophil extracellular trap formation
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04750  Inflammatory mediator regulation of TRP channels
lav04919  Thyroid hormone signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05012  Parkinson disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05135  Yersinia infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100677739 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100677739 (PLCG1)
   04014 Ras signaling pathway
    100677739 (PLCG1)
   04015 Rap1 signaling pathway
    100677739 (PLCG1)
   04370 VEGF signaling pathway
    100677739 (PLCG1)
   04064 NF-kappa B signaling pathway
    100677739 (PLCG1)
   04066 HIF-1 signaling pathway
    100677739 (PLCG1)
   04020 Calcium signaling pathway
    100677739 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100677739 (PLCG1)
   04072 Phospholipase D signaling pathway
    100677739 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100677739 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    100677739 (PLCG1)
   04660 T cell receptor signaling pathway
    100677739 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100677739 (PLCG1)
   04659 Th17 cell differentiation
    100677739 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100677739 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100677739 (PLCG1)
   04670 Leukocyte transendothelial migration
    100677739 (PLCG1)
   04062 Chemokine signaling pathway
    100677739 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100677739 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100677739 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100677739 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100677739 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100677739 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677739 (PLCG1)
   05206 MicroRNAs in cancer
    100677739 (PLCG1)
   05205 Proteoglycans in cancer
    100677739 (PLCG1)
   05231 Choline metabolism in cancer
    100677739 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100677739 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100677739 (PLCG1)
   05214 Glioma
    100677739 (PLCG1)
   05223 Non-small cell lung cancer
    100677739 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100677739 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100677739 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100677739 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100677739 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100677739 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100677739 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100677739 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100677739 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100677739 (PLCG1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100677739 (PLCG1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100677739 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100677739 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 GDPD PH_9
Other DBs
NCBI-GeneID: 100677739
NCBI-ProteinID: XP_010589988
LinkDB
Position
Unknown
AA seq 1219 aa
MEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRI
SAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPF
LEASALRAGERPELCRVSLPEFQQFLIDYQGEMWAVDQLQVQEFMLSFLRDPLREIEEPY
FFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEA
YARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILS
IEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAY
EEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDE
EEPKEASGSTELHSNEKWFHGKLGAGRDGRHIAERLLAEYCVETGAPDGSFLVRESETFV
GDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMR
LSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKI
KHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKMGTAEPDYG
ALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGD
YGGKKQLWFPSNYVEEMVSPATLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNN
RLFVFSISMASVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALE
LSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIY
PKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLTGGHCGYVLQPSTMRDE
AFDPFDKSSLRVPEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDNTKQKTEFVG
ASVLPAMVLILPWALKGPPHQRCLLSQQWPELSALAFAVDNGLNPMWPAKPFQFQISNPE
FAFLRFVVYEEDMFSDQNFLAQATFPLKGLKTGYRAVPLKNNYSEDLELASLLVKIQIFP
AKQENGDGPFSGTSLRERERSMDASGQLFHSRAREGSCEARYQPPLEDFRISQEHLADHY
DGRERRAPRRTRVNGDNRL
NT seq 3660 nt   +upstreamnt  +downstreamnt
atggaattccgcctgaagactctgagcctgcaagctacatctgaggatgaagtgaacatg
tggatcaagggcttaacttggctgatggaggatacattgcaggcggccacacccctgcag
attgagaggtggcttcggaagcagttctattcagtggatcggaatcgtgaggatcgcata
tcagccaaagacctgaaaaacatgctgtcccaggtcaactaccgggtcccgaacatgcgc
ttcctccgggagcggctgacggacctggaacagcgcagtggggacatcacctacgggcag
tttgcgcagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttc
ttggaagccagcgctctaagggctggggagcggccggagctctgccgagtgtcccttcct
gagttccagcagttcctcattgactaccagggggagatgtgggccgtggaccagctccag
gtgcaggagttcatgctcagcttcctccgagaccccttgcgagagatcgaggagccttac
ttcttcctggatgagttcgtcaccttcctattctccaaagagaacagcgtgtggaactcc
cagctggatgccgtgtgcccagacaccatgaacaaccccctgtcccactactggatctcc
tcctcacacaatacgtacctgactggggaccagttctccagcgagtcttccctggaagcc
tatgctcgttgcctgcgaatgggctgtcgctgcattgagttggactgctgggacggtcca
gatgggatgccagtcatttaccacggacacactcttactaccaagatcaagttctcagac
gtcttgcacaccatcaaggagcacgcctttgtggcctcagagtacccggtcatcctatcc
atcgaggaccactgtagcattgcccagcagaggaacatggcccagtactttaaaaaggtg
ctcggggacacactcctcaccaagcccgtggacatcgctgctgacgggctcccctcaccc
aaccagcttaagaggaagatccttatcaagcacaagaagctggctgagggcagtgcctat
gaggaggtgcctacatccgtgatgtactctgagaacgacataagcaactccatcaagaat
ggcatcctctacctggaggaccccgtaaaccatgagtggtacccccactactttgttctg
accagtagcaagatctactactctgaagagaccagtagtgaccagggcaacgaggatgag
gaggagcccaaggaggccagtggcagcacagagctgcactccaacgagaagtggttccac
gggaagctcggggccggccgggatgggcggcacatcgctgagcgcttgctcgctgagtac
tgcgttgagaccggggcgcctgacggctccttcctagtgcgcgagagcgagaccttcgtg
ggcgactacacgctgtctttctggcgaaacgggaaagtccagcactgccgtatccactcc
cggcaggatgctgggacccccaagttcttcttgacagacaacctcgtgtttgactcactc
tatgacctcatcacacactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgc
ctttcagagcctgtcccgcagaccaatgctcacgagagcaaagagtggtaccatgcaagc
ctgaccagagcccaggctgagcacatgctaatgcgggtccctcgtgatggggccttccta
gtgcggaagcggaatgagcccaactcctacgccatctccttccgggccgagggcaagatc
aagcattgccgcgtccagcaggagggccagacggtgatgctggggaactcggagtttgac
agccttgttgacctcatcagttactatgagaagcatcctctgtaccgcaagatgaagctg
cgctaccccatcaacgaggaggccctggaaaagatgggcacagctgagccagactacggg
gccctgtatgagggacgcaaccctggcttctacgtggaggcaaacccaatgccgactttc
aagtgtgcagtcaaagccctctttgactacaaggcccagagagaggatgagctgactttc
accaagagtgccatcatccagaacgtagagaagcaagagggaggctggtggcgaggggac
tatggtgggaagaagcagttgtggttcccatcaaactacgtggaagagatggtcagccca
gcgaccctggagcccgagagggagcacttggacgagaacagccccctgggggacttgctg
cggggggtcttagatgtgccggcgtgtcagatcgccatccgaccagagggcaagaacaac
cggctcttcgtcttctccatcagcatggcgtcagtggcgcagtggtccctggatgttgca
gctgactcacaggaggaactacaggactgggtgaaaaagatccgtgaagtggcccagact
gcagacgccaggctcaccgaggggaagatgatggaacggaggaagaagattgccctggag
ctctctgagcttgttgtctactgtcggcctgttcccttcgatgaagagaagattggcaca
gaacgtgcttgttaccgggacatgtcgtccttcccggaaaccaaggctgaaaagtatgtg
aacaaggccaagggcaagaagttcctccagtacaatcgactgcagctctcccgcatctac
cccaagggccagcggctggactcctccaactatgatcccttgcccatgtggatctgtggc
agccagctcgtggccctcaacttccagaccccagataagcctatgcagatgaaccaggcc
ctctttctaaccggcgggcactgcggctatgtgctgcagcctagcaccatgcgagacgag
gccttcgacccgtttgataagagcagcctccgggtaccggagccgtgtgccatctgtatc
gaggtgctgggggcccggcatctgccgaagaatggccgaggcattgtgtgtccttttgtg
gagattgaggtggcaggagctgagtatgacaacaccaagcagaagacagagtttgtgggt
gcgtctgtcttgcctgccatggtcttgatcctcccctgggcactgaagggccctccccac
cagcgatgcctcctctcccagcagtggcctgagctttctgcccttgcttttgcagtggac
aatggactgaaccccatgtggccggccaagcccttccaattccagatcagcaaccccgaa
tttgctttcttacgcttcgtggtgtatgaggaagacatgttcagcgatcagaacttcttg
gctcaggctactttccctttgaaaggcctgaagacaggatacagagctgtgcctctgaag
aacaactacagtgaggatctggagttggcctccctgctggtcaagatccaaattttcccc
gccaagcaggagaatggtgatggtcccttcagtggtacgtccctgcgggagcgggagcgg
agcatggacgcctcaggccagctgttccacagccgggcccgggaaggctcctgtgaagcc
cgctaccagccgccattggaggacttccgcatctcccaggagcatctcgcagaccactat
gatggtcgagaacggagggcccctcgaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system