KEGG   Loxodonta africana (African savanna elephant): 100659017
Entry
100659017         CDS       T04351                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X2
  KO
K02085  adenomatosis polyposis coli protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04810  Regulation of actin cytoskeleton
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100659017 (APC)
   04390 Hippo signaling pathway
    100659017 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100659017 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100659017 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659017 (APC)
   05206 MicroRNAs in cancer
    100659017 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659017 (APC)
   05225 Hepatocellular carcinoma
    100659017 (APC)
   05226 Gastric cancer
    100659017 (APC)
   05217 Basal cell carcinoma
    100659017 (APC)
   05213 Endometrial cancer
    100659017 (APC)
   05224 Breast cancer
    100659017 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659017 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100659017 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659017 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100659017 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659017 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100659017 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100659017 (APC)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100659017 (APC)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100659017 (APC)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100659017 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u9 APC_rep APC_u15 APC_N_CC Arm SAMP APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100659017
NCBI-ProteinID: XP_003405056
UniProt: G3TBM0
LinkDB
Position
Unknown
AA seq 2836 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RTFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSHEAERQNEGQGVAEISMATSGSGQGSAARMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKTSHRSKQRHKQNLYGDYVFDANRHDDNRSDNFNAGTMTVLSPYLNATVLPSSSSSRGS
LDSSRSEKDRSLERERGLGLGTYHPATENPGTSSKRSLQISTTAAQIAKVMEEVSAIHTP
QEDRSSGSTSESHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCPMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRSQSTTFPVYSE
STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSSHGINQNVNPSLCQEDDYEDDKP
TNYSERYSEEEQHEEERPTNYSIKYNEEEHHVDQPIDYSLKYASDIPAPQKPSFSFSKSS
SGQSTKTEHISSSSENASPPSSNAKRQNQLHPSSAQSRSGQAQKATSCKVPSINQETIQT
YCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQETDSANTLQIAELKENSGTRSTEETVS
EVPAVSQHIRTKSNRLQASGLSSSESTRHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMISGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTVQTKREASKNKVPNAEKRESGPKQAAINAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSVDEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQEKEVEKPTDSE
KDLLDDSDDDDIEILEECIISAMPTNSSRKDKKPAQTASKVPPPVARKPSQLPVYKLLPS
QNRLQTQKHVMPRVYCVEGTPVNFSTATALSDLTMESPPNELAAGEGVRAGAQSGEFEKR
DTIPTEGRSTDEAQRGKPSITIPELDDNKTEEGDILAECINSAMPKGKSHKPFRVKKIMD
QVQQASASSSGTNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNTETKNNLNAERTFSDN
KDSKKQSLKNNSKDLNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFD
DDDVDLSREKAELRKGKENKESEAKVTSHTELTSNQQSANKTQAVTKQPVNRGQSKPTLQ
KQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKENEPV
KETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAM
PKKKKPSRLKGDNEKHSPRNMGGILAEDLTLDLKDTQRPDSEHGLSPDSENFDWKAIQEG
ANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRI
LKPGEKSTLETKKIESENKGIKGGKKVFKSLITGKVRSNSEVSSQMKQPLQTNMPSISRG
RTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSESQTATTSPRGAKPSVKSELSPVTR
QTSQPGGSNKGPSRSGSRDSTPSRPAQQPLSRPVQSPGRNSISPGRNGISPPNKLSQLPR
TSSPSTASTKSSGSGKMSYTSPGRQMSQQNLAKQTGFPKNGSSIPRSESASKGLNQMSNS
NGSNKKVELSRMSSTKSSGSESDRSERPILVRQSTFIKEAPSPTLRRKLEESASFESLSP
SSRPNSPTRSQAQTPVLSPSLPDMSLSTHSSVQPGGWRKLPPNLSLTVEYNDGRPAKRHD
IARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSE
DEKHVNSISATKQTKENHVPTKGTWRKIKESEISPTNSTSPTTSSGATNGAESKTLIYQM
APAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTVSEKGDPNVKDSKDNQGKQDVG
NGSAPVRTMGLENRRNSFIQVDSPDQKGTEAKAGQSNAVPAPENSESSIAERTPFSSSSS
SKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDNTESSG
TQSPKRHSGSYLVTSV
NT seq 8511 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaagcagctacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgacttactagaacgacttaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttacggaagccgggaa
ggatctgtttcaagtcgttcaggagagtgcagtcctgttcctatgggttcatttccaaga
agaacatttgtaaacggaagcagagaaagtactggatatttagaggaacttgagaaagaa
agatcattacttcttgctgatcttgacaaggaagagaaagaaaaagattggtattatgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcttta
caaacagatatgaccagaaggcaattggaatatgaagcaaggcaaatcagagttgcaatg
gaggaacaactgggtacttgccaggatatggaaaaacgagcacagcgaagagtaaccagg
attcaacaaatagagaaggacatacttcgtatacgacagcttttgcagtcccaagcaaca
gaagcagagagatcatctcagagcaagcatgaagcaggctctcatgaagcggagcggcag
aatgaaggtcaaggagtggcagaaatcagcatggcaacttctggtagcggtcagggttcg
gctgcacgaatggaccatgagacagccagtgttttgagttctagtagcacacactctgct
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcacgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgcctgcc
cctgttgaacatcagatctgtcctgccgtgtgtgttctaatgaaactgtcatttgatgag
gagcatagacatgcaatgaatgaacttggaggactacaggctattgcagaattattgcaa
gtggactgtgagatgtatgggcttactaatgaccactacagtgttactttaagacgatat
gctggaatggctttgacaaacttaactttcggagatgtagccaacaaggctactctgtgc
tctatgaaaggctgcatgagagcgcttgtggctcaactaaaatctgaaagcgaagacttg
cagcaggttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaag
aagacattgcgtgaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaa
aaggaatcaaccctcaaaagcgtactgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgctgtagacggtgcgcttgcatttttggttggcactctc
acttaccggagccagacaaatactttagcaattattgaaagtggaggtgggatactacgc
aatgtgtctagcttgatagctacaaatgaggaccacaggcaaatcttaagagagaacaac
tgcttacaaaccttattacaacacttaaaatctcacagtttgacaatagtgagtaatgca
tgtggaaccttgtggaatctctcagcaagaaatcctaaagaccaagaagcattatgggac
atgggggcagttagcatgctcaagaacctcattcattcaaagcacaaaatgattgcaatg
ggaagtgctgcagctttaaggaatctcatggcaaacagacccgcaaagtataaggatgcc
aatattatgtctcctggttcaagcctgccatctcttcatgttaggaaacaaaaagccctc
gaagcagaattagatgctcagcatttatcagaaacttttgacaatattgacaatttaagt
cccaagacatctcatcgtagtaagcagagacacaagcagaatctctatggtgactatgtt
tttgacgccaatcggcacgatgataatagatcagacaattttaatgctggaaccatgact
gtcctttcaccatatttaaatgctacagtgttgcctagctcctcttcatcaagaggaagt
ttagatagttctcgttctgaaaaagatagaagtttggagagagagcgaggacttggccta
ggcacctaccatccagcaacagaaaatccaggaacctcttcaaagcgaagtttgcagatc
tccactactgcagcccagattgccaaagtcatggaggaagtgtcagccattcatacccct
caagaagacagaagttctgggtcaaccagtgaatcacattgtgtaacagatgagagaaat
gcactgagaagaagctctgctgcccacacgcattcaaatacctacaacttcactaagtca
gaaaattcaaataggacatgtcctatgccttatgctaaattggaatataagagatcttcg
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggtcaaatgaaa
ccctcaattgaatcttattctgaagacgatgaaagcaaattttgcagttatggtcagtat
ccagctgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ttagatacaccaataaattatagtcttaaatattcagatgagcagttgaactctggaagg
caaagtccttcacagaatgaaagatgggcaagacccaaacacataatagaagatgaaata
aaacaaagtgagcaaaggcaatcaaggagtcagagtacaacttttcccgtatatagtgag
agcactgatgataaacacctcaagttccaaccacattttggacagcaagaatgtgtttcc
ccatataggtcaaggggagccaatggttcagaaactaatcgagtgggttctagtcatgga
attaatcaaaacgtaaacccgtctttgtgtcaggaagatgattatgaagatgataagcca
accaactatagcgaacgttactctgaggaagagcagcatgaagaagagagaccaacaaat
tacagcataaaatataacgaagaggagcatcatgtggatcaacctattgattacagttta
aaatatgcctcagatatcccagccccacagaaaccatcattttcattctcaaagagttca
tctggacaaagtactaaaactgaacacatctcttcaagcagtgagaatgcatccccaccg
tcatctaatgccaagaggcaaaatcagcttcatccaagttcagcacaaagcagaagtggt
caggcccaaaaagctacctcttgcaaagttccctctatcaaccaagaaacaatacagact
tactgtgtagaagataccccaatatgtttttcaaggtgtagttcattatcatctttgtca
tcagctgaagatgaaataggatgtgatcagacaacacaggaaacagattctgctaatact
ctgcaaatagcagaactgaaagaaaacagcggaactagatcaactgaggaaactgtgagt
gaagttccagcagtgtctcagcacattaggaccaaatccaacagactccaggcttctggt
ttatcatcctcagaatcaaccaggcacaaggctgttgaattttcttctggggctaaatcg
ccatcaaagagtggtgctcagacacctaaaagtccaccagagcactacgttcaggagact
ccactcatgtttagcagatgtacttctgtcagttcacttgatagttttgagagtcgttcg
attgctagctctgttcagagcgaaccctgcagtggaatgataagtggcattataagcccc
agtgaccttccagatagccctggacaaaccatgccaccaagcagaagtaaaacccctcct
cctcctcctcaaacagttcagactaagcgagaggcatctaaaaataaagtacctaatgct
gaaaagagagagagtggacctaagcaagctgctataaatgctgcagttcagagggtccaa
gttctcccagatgctgatacgttattacattttgccacagaaagcactccagatggattt
tcctgttcgtctagcctgagtgctctgagtgtcgatgaaccgtttatacagaaagatgtg
gaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaacagaatctgag
cagcctgaagaatcaaatgaaaaccaagaaaaagaggtagagaaacctactgactctgaa
aaggatctgttggatgattcagatgatgatgatattgaaatattagaagaatgtattata
tctgccatgccaacaaattcatcacgcaaagacaaaaagccagcccagactgcttcaaaa
gtacctccacctgtagcaaggaaaccaagtcagcttcctgtgtacaaacttctgccatca
caaaacaggttacaaacacaaaagcatgtgatgccccgggtatactgtgtagaagggaca
cctgtaaacttttccacggctactgctctaagtgatctaacaatggaatcccctccaaat
gaattagctgctggagaaggggttagagcaggggcacagtcaggtgaatttgaaaaacgg
gataccatacctacagagggcagaagtacagatgaggctcaaagaggaaaaccatctata
accatacctgaactggatgacaataagacagaggaaggtgatattcttgcagaatgcatt
aattctgctatgcccaaaggaaaaagtcacaagcctttccgtgtgaaaaagatcatggac
caggtccaacaagcatctgcatcgtcatctggaaccaacaaaaaccaattagatggtaag
aaaaagaaacctacttcaccagtaaagcctataccacaaaatactgaatataggacacgt
gtaagaaaaaatacagagacaaaaaataatttaaatgctgaaagaactttctcagacaac
aaagactcaaagaaacagagcttgaaaaataactctaaggatttgaatgataagctgcca
aataatgaagatcgagttagaggaagctttgcttttgattcacctcatcattacacacct
attgaaggaactccttactgcttttcacgaaatgattctttgagttctctagattttgat
gatgacgatgttgacctttccagagaaaaggctgaattaagaaaggggaaagaaaataag
gaatcagaagctaaagtcaccagccacacagaattaacctcaaaccaacaatcagctaat
aagacacaggctgttacaaaacagccagtgaatcgaggtcagtctaagcccacactgcag
aagcaatccacttttccccagtcatccaaagacataccagacagaggggcagccactgat
gaaaaattacagaattttgctattgaaaatactccagtttgcttttctcgtaattcttcc
ctgagttctctcagtgacattgaccaagaaaacaacaacaacaaagaaaatgaacctgtc
aaagagactgagccccctgactcacaaggcgaacccagtaaacctcaggcatcaggttat
gcgcctaaatcatttcatgttgaagatacccctgtttgtttctcgagaaacagttctctc
agttctcttagtattgattctgaagatgaccttttacaggaatgtataagttctgcaatg
ccaaaaaagaagaagccttccagactgaagggtgataatgaaaagcatagccctagaaat
atggggggtatattagcagaagatttgacacttgatttgaaagatacacagagaccagat
tcagaacatggtttatcccctgattcagaaaattttgattggaaagctattcaggaaggt
gcaaattccatagtgagtagtttacatcaagctgctgctgctgcttgtttatctagacag
gcttcatctgattcagattccatcctttcgctgaaatcaggaatctcgttgggatcacca
tttcatctcacacctgatcaagaggaaaaaccctttacaagtaataaaggcccacgaatt
ctaaaacctggggagaaaagtacattggaaactaaaaagatagaatctgaaaataaagga
atcaaaggaggaaaaaaagtttttaaaagtttgattactggaaaagttcgatctaattca
gaagtttcaagccaaatgaaacagccccttcaaacaaacatgccttcaatttctcgaggt
aggacaatgattcatattccaggagttcgaaatagctcttcaagtacaagtcctgtttct
aaaaaaggcccaccccttaagactccagcctccaaaagtcctagtgaaagtcagacagcc
accacttctcctagaggagccaagccttcagtaaagtcagaattaagccctgttaccagg
cagacatcccaaccaggtgggtcaaataaaggaccttctagatcaggatctagagattcc
actccttcaagacctgcccagcaaccattaagtagacctgtgcagtctccagggcgaaac
tcaatttctcctggtagaaacggaataagtcctcctaataaattatctcagttgccaagg
acatcatcccctagtactgcttcaactaagtcctcggggtctgggaagatgtcatataca
tccccaggaagacaaatgagccaacagaaccttgccaaacaaacaggttttcccaagaat
ggcagtagtatcccaagaagtgagtctgcgtccaaagggctaaatcagatgagtaatagc
aatggatccaataaaaaggtagaactttctagaatgtcttcaactaaatctagtggaagt
gaatctgatagatcagagagacccatattagtacgccagtcaactttcatcaaagaagct
ccaagcccaaccctaaggagaaaactggaggaatctgcttcatttgaatctctttctcca
tcttctagaccaaattctcccactaggtcccaggcacagacccctgttttaagtccttca
cttcctgatatgtctctatccacacattcgtctgttcagcctggtggatggcgaaaactc
ccacctaacctcagtcttactgtagagtataatgatggaaggccagcaaagcgccatgat
atagcacgctcccattctgaaagtccttccagacttccaatcaacagatcaggaacctgg
aaacgtgagcacagcaaacattcatcgtcccttcctcgcgtaagcacttggagaagaact
ggaagttcatcctcaattctttctgcttcatcagagtccagtgaaaaagcaaaaagtgag
gatgaaaaacatgtgaactctatttcagcaaccaagcaaactaaagaaaaccacgtaccc
acaaaaggaacatggagaaaaataaaagaaagtgaaatttctcccacaaatagtacttcc
ccgaccacttcctcaggtgctacaaatggtgctgagtcaaagactctaatttatcaaatg
gcacctgctgtttctaaaacagaagatgtttgggtgagaattgaggactgtcccattaac
aatcctagatccggaagatctcccacaggaaatactcccccagtgattgacactgtttca
gaaaaaggagatccaaacgttaaagattcaaaagataatcagggaaaacaggatgtgggt
aatggcagtgctcctgtacgcaccatgggtttggaaaaccgcaggaactcttttattcag
gtagacagcccagaccaaaaaggaactgaggcaaaagcgggacaaagtaatgctgtccct
gcaccagagaatagtgaaagctctatagctgagcgtaccccattcagttctagcagctca
agcaaacacagttcacctagtgggaccgttgctgctagagtgactccttttaattataac
ccaagccctaggaaaagcagtgcagatagcacttcagcccggccatctcagatcccgaca
ccagtgaataacaacacaaagaaacgagattcaaaaactgacaacacagaatccagtgga
actcaaagtcctaagcgccattctgggtcttaccttgtgacatctgtttaa

DBGET integrated database retrieval system