KEGG   Loxodonta africana (African savanna elephant): 100659041
Entry
100659041         CDS       T04351                                 

Gene name
FABP9
Definition
(RefSeq) fatty acid-binding protein 9
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100659041 (FABP9)
   03320 PPAR signaling pathway
    100659041 (FABP9)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 DUF3641
Other DBs
NCBI-GeneID: 100659041
NCBI-ProteinID: XP_003408412
UniProt: G3T3F9
LinkDB
Position
Unknown
AA seq 133 aa
MMVEPFLGTWKLVSSENFEDYMKELGVSFAARNLAGLVKPTVSISVDGDVVSIRTESSFK
NTAISFKLGEEFEETTADNRKVKSIITLDSGSMIQVQKWLGKQTTIKRQIVDGKMVVECT
MNNIVSTRVYEKV
NT seq 402 nt   +upstreamnt  +downstreamnt
atgatggttgagcccttcttgggaacctggaagctggtctccagtgaaaactttgaggat
tacatgaaagaactgggagtgagctttgctgcccggaacctggccgggttagtgaagcca
actgtcagcatcagtgtcgatggggacgtggtgagcatcagaaccgaaagttctttcaag
aacactgcgatctccttcaagctgggggaagagtttgaggagaccacagcagacaaccgg
aaagtgaagagcatcataacattagacagtggctcgatgattcaggtccaaaagtggctc
ggcaaacagacaacaatcaaaagacaaattgtagatggaaaaatggtagtggaatgtacc
atgaacaatatcgtcagcactagagtctatgaaaaagtatga

KEGG   Loxodonta africana (African savanna elephant): 100660274
Entry
100660274         CDS       T04351                                 

Gene name
FABP4
Definition
(RefSeq) fatty acid-binding protein, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100660274 (FABP4)
   03320 PPAR signaling pathway
    100660274 (FABP4)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 100660274
NCBI-ProteinID: XP_003408283
LinkDB
Position
Unknown
AA seq 132 aa
MCDAFVGTWKLVSSENFDEYMKEVGVGFATRKVGGMAKPNLIISVNGDVITIRSESTFKN
TEISFKLGQEFDEITADDRKVKSIIILDGGALVHVQKWDGKSTTIKRKRVDDKLVVECIM
KDITSTRIYERT
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgtgatgcatttgtaggtacctggaaactggtctccagtgaaaactttgatgaatac
atgaaagaagtgggagtgggctttgccacccggaaagtgggtggcatggccaaacccaac
ttgatcatcagtgtgaatggggatgtgatcactattaggtcagaaagtacctttaaaaat
actgagatttccttcaaactgggtcaggaatttgatgaaatcactgcagatgacaggaaa
gtcaagagcatcataatcttagatgggggtgctctggtacacgtgcagaagtgggatgga
aaatcaaccaccattaagagaaaacgagtggacgacaaactggtggtggaatgcatcatg
aaagacatcacttccaccagaatttatgagagaacataa

DBGET integrated database retrieval system