KEGG   Loxodonta africana (African savanna elephant): 100659046
Entry
100659046         CDS       T04351                                 

Gene name
TSHR
Definition
(RefSeq) thyrotropin receptor isoform X1
  KO
K04249  thyrotropin receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04918  Thyroid hormone synthesis
lav04923  Regulation of lipolysis in adipocytes
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100659046 (TSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659046 (TSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100659046 (TSHR)
   04918 Thyroid hormone synthesis
    100659046 (TSHR)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100659046 (TSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100659046 (TSHR)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    100659046 (TSHR)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100659046
NCBI-ProteinID: XP_003408852
UniProt: G3SMY9
LinkDB
Position
Unknown
AA seq 764 aa
MRQKSLLQLVLLLALPRNLGGKECSPPPCECRQDDDFRVTCKDIHRIPSLPASTETLKFT
ETHLETIPSHAFSNLPNISRIYLSIDATLQRLESHSFYNMSKMTHIEIRNTRSLTYIDPG
ALKELPLLKFLGIFNTGLKVFPDLTKIYSTDVFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGHAFNGTKLDAVYLNKNKHLTVIDKDAFGGVYSGPTLLDISYTSVTD
LPSKGLENLKELIARNTWTLKKLPLSLSFIHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSIRSLRQRKSANALNGPFYQEYEEDPDDSSAGYNVNSKFQDTPSNSHYYVFFEEQE
DEIIGFGQELKNPQEEALLAFDSHYDYTVCGDNEEIMCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLFVLLTSHYKLTVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
VMVAGWVCCFLLALLPLVGISSYAKVSICLPMDTDTPLALAYIVLVLVLNIVAFIIVCSC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLNKFGICKHQAQAYRSQGVSLKNSTGIQ
IHRVTRDMRQSLPNMPGDYELIENSYLAPNKQGQIPEEYKQTVL
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgaggcagaagtccctgctgcagctggtgctgctgctcgccctgcccaggaacctgggg
ggaaaggagtgttcccctccgccctgtgagtgccgccaggacgacgacttcagagtcacc
tgcaaggatattcaccgcatccccagccttccggccagtacggagactctgaagtttaca
gagactcatctggaaaccattcccagtcatgcattttcaaatctgcccaatatttccagg
atctacttatcaatagacgcaactctgcagcgactggaatcacattccttctacaatatg
agtaaaatgactcacatagagatccggaataccagaagcttaacttacatagaccctggt
gccctaaaagagctccccctcctgaagttccttggaattttcaacactggacttaaagta
tttcctgacttgaccaaaatttattccactgatgtattctttatacttgaaattacagac
aacccttacatgacttcaattcctgtgaatgcttttcaggggctgtgcaatgaaaccttg
acactgaaactatacaacaatggctttacttctgtccaaggacatgctttcaatgggaca
aagctggatgctgtttacctgaacaagaataaacacctgacggttattgacaaggatgca
tttggaggagtatacagtggaccgaccttgctggacatctcctataccagtgttacagac
ctgccatccaaaggcctagagaacttgaaggaactgatagcaaggaacacttggacgctg
aagaaactcccactttccttgagtttcattcatctcacacgagctgacctttcttatcca
agccattgctgtgcttttaagaatcagaagaaaatcagaggaatccttgagtccttaatg
tgcaatgagagcagtattcggagcctacgtcagaggaaatctgcgaatgccttgaatggc
cccttttaccaggaatatgaggaggatccagatgacagcagtgctgggtataatgtaaac
tccaagttccaggatacccccagcaactctcattattatgtgttctttgaagaacaagag
gatgagatcattggttttgggcaggagctcaaaaacccccaggaagaggccctactggcc
tttgacagccactacgactacactgtgtgtggggacaatgaggagataatgtgcaccccc
aagtcagatgagttcaacccctgtgaggacataatgggctacaagttcctgagaattgtg
gtgtggtttgtgagtctactggctcttttgggcaatgtctttgtcctgtttgtcctcctc
actagccactacaaactgactgttccacggtttctgatgtgcaacttggcctttgcagac
ttctgtatggggatgtacctgctccttattgcctctgtagacctctacactcactctgag
tactacaaccatgccatcgactggcagacaggccctgggtgcaacacagctggttttttt
actgtctttgccagtgagttgtcagtgtacacactgacggtcatcaccttggaacgctgg
tatgccatcaccttcgccatgcgcctggaccggaagattcgcctcaggcacgcatgcgcc
gtcatggttgcaggctgggtttgctgcttcctgctcgccctgctccctttggtgggaata
agtagttatgccaaggtcagtatctgcctgcccatggacaccgacacccctcttgctctg
gcctacattgtccttgttctggtgctcaacatagtcgccttcatcatcgtatgctcctgt
tacgtgaagatctacattacagtccgaaacccccagtacaacccaggggacaaagacacc
aagattgccaagaggatggctgtgttgatcttcactgacttcatgtgcatggccccgatc
tcattctatgctttgtcagcacttatgaacaagcctctcatcaccgttaccaactccaaa
atcttactggttctcttctatcctcttaactcctgtgccaatccattcctctatgctatt
ttcaccaaggccttccagagggatgttttcatcctgctcaacaagtttggcatctgtaaa
caccaggctcaagcatacaggagccagggagtttctctaaagaacagcactggcattcag
atccacagggttacccgagacatgagacaaagtcttcccaacatgccaggtgactatgaa
ctgattgaaaactcctatctagccccaaataagcagggccaaatcccagaagagtataag
caaacagttttgtag

DBGET integrated database retrieval system