KEGG   Loxodonta africana (African savanna elephant): 100659082
Entry
100659082         CDS       T04351                                 

Gene name
EI24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100659082 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 100659082
NCBI-ProteinID: XP_003417473
LinkDB
Position
Unknown
AA seq 340 aa
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWLSLLLFYRVFIPGLQSVTAQIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLLQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKAAAGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgacagtgtcaaaacctttctccaggacctggccaggggaatcaaggactccatc
tggggtatctgtaccatctcaaagctggatgctcgaatacaacagaagagggaggaacaa
cgtcgaagaagggcaagcagtgtcctggcacagaggagagcccagagtatagagcggaag
caagagagtgagccacgtatcgttagtagaattttccagtgttgcgcttggaatggagga
gtattttggttgagtctcctcttgttttaccgagtgtttattcctgggcttcagtcagta
acagcacaaattattggtgatccatcattgcacggagatgtttggtcgtggctggaattc
ttcctcacatcaattttcagtgctctttgggtgctccccctgtttgtgcttagcaaagtt
gtcaatgccatttggttccaagatatagctgatctggcatttgaagtgtcagggaggaag
cctcacccattccctagtgtcagcaaaataattgctgatatgctcttcaaccttctgctg
caggctcttttccttctccagggaatgtttgtgagtctctttcccatccatcttgttggt
cagctggttagtctcctgcatatgtcccttctgtattctctgtactgctttgaatatcgc
tggttcaataaaggaattgaaatgcaccagcggttgtcaaacatagaaaggaattggcct
tactactttggatttggtttgcccttggctttcctcacagccatgcagtcctcatacatt
atcagtggctgcctcttctccatcctctttcctttattcattatcagcgccaatgaagca
aagacccctggcaaagcatacctttttcagttgcgcctcttctccttggtggtcttcttg
agcaacagactctttcacaagacggtttacctgcagtctgctctgagtagctcaacgtct
gccgagaagttcccttcaccacacccgtctcctgccaaactgaaggctgctgcaggccac
tga

KEGG   Loxodonta africana (African savanna elephant): 100667114
Entry
100667114         CDS       T04351                                 

Gene name
TP53I3
Definition
(RefSeq) LOW QUALITY PROTEIN: quinone oxidoreductase PIG3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100667114 (TP53I3)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     100667114 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 100667114
NCBI-ProteinID: XP_010590339
LinkDB
Position
Unknown
AA seq 374 aa
MLVVLFDKLGRPENLXLKEVAKPSPGEDEVLPIVAKWHRALPVTHLDMCAEPVSGVLRVD
LYLGKRGSRMVTHRFLIMLTTCVLLSLQRKGQYTPPPAASSILGLEASEHVAKLGPGCQG
HWKPGDSAMAVLPGGGQAQYATVPKGLLMPIPVGLSLFQAAAIPEAWLTTFQLLYLLGNV
QARQFVLIHVGSSGVGTAAIQLTQMAGAILLVMAGSQHKLRMAEKLGAAAGFDYKEEDFC
EATLKFTKGAGANLILDCVGGSHWEKNVNCLAVDGXLHGLMRVANINGPLLSKLLFKGGS
LITSLLKYRQIDQKYKQMLVKASTERALPHFSRKDPQRLLPLLDRVYLLMEIQEAHVYTE
TDKNMGKIVMKLPQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgttagttgtgctgtttgacaagctgggaagaccagaaaacctttagctaaaggaggtg
gccaagccgagcccaggagaggatgaagtcctccccatagtggctaaatggcacagggcc
ctgccagtaactcatctggatatgtgtgcagagccagtgtcgggagttctgagagttgac
ctttatttgggaaaaagggggtcaagaatggtgacacacagatttctgatcatgctcacc
acttgtgtgctcctctctctgcagagaaaaggccagtacaccccacctccagcagccagc
agcattttgggacttgaggcatctgaacatgtggccaaactggggcctggatgtcagggg
cactggaagcctggagattcagccatggctgtgctgcctggtgggggccaggctcagtat
gccactgttcccaaaggactcctcatgcccatcccggtgggactgtccctgtttcaggct
gcagccatcccggaggcctggctcaccaccttccagctgttatatcttctgggaaatgtt
caggccagacagtttgtgctaatccatgtggggtcaagtggtgtgggcacagctgccatc
caactcacccagatggctggagctattcttctggtcatggctggctcacagcacaagctt
cgaatggcagaaaagcttggagcagctgctggattcgattacaaagaagaggacttttgt
gaagcaacactgaaattcaccaaaggtgctggagccaaccttattctagactgtgtaggc
ggatctcactgggagaagaatgtcaactgcctggctgttgatggtnntctccatggtctg
atgcgagtagctaacatcaatgggcctctgttatccaagctactttttaaaggaggaagc
ctaatcaccagtctgctaaaatatagacaaatagatcaaaaatataagcaaatgctggtg
aaggcttccacggaacgagctctgcctcacttctccaggaaggacccccaacgtctattg
ccacttctggatagagtctacctgttgatggaaatccaagaggcccatgtgtacacggag
actgacaagaacatgggcaaaatcgtcatgaagctgccccagtga

KEGG   Loxodonta africana (African savanna elephant): 100667395
Entry
100667395         CDS       T04351                                 

Definition
(RefSeq) quinone oxidoreductase PIG3-like
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100667395
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     100667395
SSDB
Motif
Pfam: ADH_zinc_N
Other DBs
NCBI-GeneID: 100667395
NCBI-ProteinID: XP_023406352
LinkDB
Position
Unknown
AA seq 340 aa
MESTEDRRAQRVPYQADSKPSPPTEASCVPTSGIVPPASGWCAHGETEEEPRESLLLAQK
LAWYQEVNCTSSSRESYKMLAVHLDKPGGPENLYLKEVDKPNPGEGEVFLKVAANTLNRI
GLTSDSSPSARLIPQKCSSDQGPLCSKTLDGSSHSGPSVNQALPNPLAFSPVTPTVLYTP
ALGGLCFQSQPCTSPPSPPLLAQGFLTWIIATGDIQEGETVLIHASRRGVSTADIHFTRP
FKAIPPEIMHSKENIQMAQNLGAAAGFDYKKEDFSEEALKAAQGMYVCVCVFEEEAVLIL
TPQLNCSSPTSSSFINFSSSFLFCISYLLLPNRLLGNLVA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagtccacagaagacaggagagcacagagggtcccctatcaggctgactccaagccc
tcccctcccacagaggcatcctgcgtccccacctctgggattgtcccaccagcctcaggg
tggtgtgcccatggagaaacagaagaggagcccagagaaagtctcttgctggcacagaag
ctggcatggtaccaagaggtgaactgcaccagttcctccagggaaagttataaaatgtta
gctgtgcacttagacaagccaggaggaccagaaaacctttacctaaaggaggtggacaag
ccgaacccaggagagggcgaagtcttcctcaaggtggcagccaacaccctgaacaggatt
ggacttacttcagactccagtccctctgctagattgatcccgcagaagtgcagctctgat
caaggccccctctgctccaaaacccttgatggctcctcacattcagggccttctgtgaac
caggcgctacctaaccctctagccttctctcctgttacccccacagtgctctacactcca
gcactaggtggtttgtgtttccagagtcaaccctgcacctccccaccctctccacctttg
cttgcccagggttttctaacttggatcattgccacaggagatatacaagagggagagaca
gtgctcatccatgccagcaggagaggtgtgagcacagctgacattcacttcactaggccg
ttcaaagccattcccccagagatcatgcactccaaggagaacattcaaatggcccagaat
ctgggtgctgcagctggatttgattataagaaggaggacttctctgaggaggctctgaag
gccgcccagggtatgtacgtgtgtgtttgtgtgtttgaagaagaggccgtactgatcctt
actcctcagcttaactgttcttctcctacttcctcctctttcataaacttttcctcctcc
ttcctcttctgtattagttatctgttgctgcctaacaggttactcggaaacttagtggct
taa

DBGET integrated database retrieval system