KEGG   Loxodonta africana (African savanna elephant): 100659106
Entry
100659106         CDS       T04351                                 

Gene name
KCNQ5
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 5
  KO
K04930  potassium voltage-gated channel KQT-like subfamily member 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100659106 (KCNQ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659106 (KCNQ5)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100659106 (KCNQ5)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 100659106
NCBI-ProteinID: XP_003404443
LinkDB
Position
Unknown
AA seq 924 aa
MPRHHAGGEEGGAAGLWVKSGAAVAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAAALGGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVL
ERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRI
WSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQI
LRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYA
DALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHR
QKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTNQKLSFKERVRMA
SPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVI
DADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKD
VIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKIMAEHETTDDLSMLGRVVK
VEKQVQSIESKLDCLLDIYQQVLRKGSTSALTLASFQIPPFECEQTSDYQSPVDSKDLST
SAQNSGCLSRSASANISRGLQFILTPNEFSTQTFYALSPTMHSQATQVPMSQSDGSAMAA
TNNIANQINAAPKPAAPTTLQIPPPLPAIKHLPRPEPLHSNPTGLQESISDVTTCLVASK
ENVQVAQSSLTKDRSLRKSFDMGGETLLSVRPMVPKDLGKSLSVQNLIRSTEELNIQLSG
SESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDTTLQPAREATFASDSLRTGRS
RSSQSICKAGESTDALSLPHVKLK
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgccccgccaccacgcgggaggagaggagggcggcgccgccgggctctgggtgaagagc
ggtgcggcggtggcggccgcgggcggggggcgcctgggcagcggcatgaaggatgtggag
tcgggccggggcagggtgctgctgaactcggcggccgccaggggcgacggcctcctgctg
ctgggcacccgcgcggccgcgctcggcggcggcggcggcggcggcctgagagagagccgc
cggggcaagcagggggcccggatgagcctactggggaaaccgctctcgtacaccagtagc
cagagctgccggcgcaacgtcaagtaccggcgggtgcagaactatttgtacaacgtgctg
gagagaccccgaggctgggcattcatctaccacgcgtttgttttcctccttgtcttcggt
tgcttgattttgtcagtgttttctaccatccctgagcacacaaaattggcctcaagttgc
ctgttgattctggagtttgtgatgattgtcgtctttggtttggagttcatcattcgaatc
tggtctgcaggttgctgttgtcggtatagaggatggcaaggaagattgaggtttgcccga
aagcctttctgtgttatagataccattgttcttatcgcttcaatagcagtcgtttctgca
aaaactcagggtaatatttttgccacgtctgcactcagaagtctccgtttcctgcagatt
ctccgtatggtgcgcatggaccgaaggggaggcacttggaaattactaggctctgtggtt
tacgcacacagcaaggaattaatcacagcttggtacattggatttttggttcttattttt
tcatctttccttgtctatctggtggaaaaggatgccaataaagagttttctacatatgca
gatgctctctggtggggcacaattacgttaacaacgattggctatggagacaaaactccc
ctcacttggctgggaagattgctttctgcaggctttgcactccttggcatttctttcttt
gcccttcctgccggcattcttgggtcaggttttgcactaaaagtacaagaacagcaccgc
cagaaacattttgagaaaagaaggaacccagctgccaatcttatccagtgcgtttggcgt
agttatgcagctgatgaaaaatctgtttccattgcgacctggaagccacatttgaaggcc
ttgcacacctgcagtcctaccaatcagaagctaagttttaaggagcgagtgcgcatggct
agcccgaggggccagagtattaagagcagacaagcctcggtaggtgacaggaggtccccg
agcaccgacatcacagccgagggcagccccaccaaagtgcagaagagctggagcttcaac
gaccgaacccgcttccggccctcgctgcgcctcaaaagttctcagccaaaaccagtgata
gatgctgacacagctcttggcactgatgatgtatatgatgagaaaggatgccagtgtgat
gtatcagtagaagacctcaccccaccgcttaaaactgttattcgagccatcagaattatg
aaattccatgttgcaaaacggaaatttaaagaaacattacgtccatatgatgtaaaagat
gtcattgaacaatattctgctggccatctggacatgttgtgtagaattaaaagccttcaa
acacgtgtcgatcaaattcttggaaaagggcaaatcacatcagacaagaaaagccgagag
aaaataatggcagaacatgagaccactgatgacctcagtatgctcggccgggtagtcaag
gttgaaaaacaggtacagtccattgagtccaaactggactgcctactagacatatatcaa
caggtcctccggaaaggctccacctcagccctcactttggcttcattccagatcccacct
tttgaatgtgaacagacatctgactatcaaagccctgtggacagcaaagacctatccact
tccgcacaaaacagtggctgcttatctagatcagctagtgccaacatctcacggggcctg
cagttcattctgacgccaaatgagttcagcactcagactttctatgcgcttagccctact
atgcacagtcaagcaacacaggtgccaatgagtcaaagtgatggctccgcaatggcggcc
accaacaatattgcaaaccaaataaacgcggcacccaagccagcagccccaacaacttta
cagatccctcctcctctcccagccatcaagcatctgcccaggccagaacccctgcactca
aaccctacaggcttacaggaaagcatttctgacgtcaccacctgccttgttgcctccaag
gaaaatgttcaggttgcacagtcaagtctgaccaaggaccgttctctgaggaaaagtttt
gacatgggaggagaaactctgttatctgtccgtcccatggtgccgaaggatttgggcaaa
tccttgtctgtacaaaacctgatcaggtcaacagaagaactgaatatacagctttcaggg
agtgagtcaagtggctccagaggcagtcaagatttctaccccaaatggagggaatccaaa
ttgtttataactgatgaagaggtgggtcccgaagagaccgagacagacacttttgatacc
acgctgcagcccgccagggaagctacttttgcgtcagactctttaaggactggaagatca
cgatcatctcaaagcatttgtaaggcaggagaaagtacagatgccctcagcttgcctcat
gtcaaactgaaataa

KEGG   Loxodonta africana (African savanna elephant): 100661939
Entry
100661939         CDS       T04351                                 

Gene name
KCNJ2
Definition
(RefSeq) inward rectifier potassium channel 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100661939 (KCNJ2)
   04924 Renin secretion
    100661939 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    100661939 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    100661939 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100661939 (KCNJ2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100661939 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 100661939
NCBI-ProteinID: XP_010595294
UniProt: G3SZK9
LinkDB
Position
Unknown
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFILSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGLPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctatagcattgtctcttcggaagaagacggcatgaag
ttggccaccatggcagtggcaaatggctttgggaacgggaagagtaaagtccacactcga
cagcagtgcaggagccgctttgtgaagaaagatggccactgtaatgttcagttcatcaac
gtgggggagaaaggacaacggtacttggcagacatctttaccacgtgtgtggacatccgc
tggcggtggatgctggttatcttctgcctggctttcattctctcgtggctgttttttggc
tgtgtgttttggctgatagctctgctccatggggacctggatgcatcgaaggagagcaaa
gcttgtgtgtctgaggtcaatagcttcaccgctgccttcctcttctccattgagacccag
acaacaataggctatggcttcaggtgtgttactgacgaatgcccgattgctgttttcatg
gtggtgttccaatcgattgtgggctgcatcatcgatgccttcatcattggtgctgtcatg
gcgaagatggcaaagccaaagaagagaaatgagactctcgtcttcagtcacaatgctgtg
attgccatgagagatggcaagctatgtttgatgtggcgagtgggcaatcttcggaagagc
catttggtggaagctcacgttcgagcacagctcctcaaatccagaattacttctgaaggg
gagtatatcccactggatcaaatagacatcaatgttgggttcgacagtggaattgaccgt
atatttctggtgtccccaatcacaatagtccacgaaatagatgaggacagtcctttatat
gatttaagtaaacaggatattgacaatgcagactttgaaatcgtggtaatactggaaggc
atggtggaagccaccgccatgacaacacaatgtcgtagctcttacctggcaaacgaaatc
ctttggggccaccgctatgagcctgtactctttgaagagaagcactactacaaagtggac
tattcaaggttccacaaaacatatgaagtacccaacactcccctttgtagtgccagagac
ttagcggaaaagaaatatatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagatgacagtgaaaatggacttccagaaagcactagtaca
gacactccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagaatcagagatatga

KEGG   Loxodonta africana (African savanna elephant): 100666015
Entry
100666015         CDS       T04351                                 

Gene name
KCNJ4
Definition
(RefSeq) inward rectifier potassium channel 4
  KO
K04998  potassium inwardly-rectifying channel subfamily J member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100666015 (KCNJ4)
  09156 Nervous system
   04725 Cholinergic synapse
    100666015 (KCNJ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666015 (KCNJ4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100666015 (KCNJ4)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 100666015
NCBI-ProteinID: XP_003419813
LinkDB
Position
Unknown
AA seq 444 aa
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEVSPAVPAAGAPAGSGGAAPVAPKPCIMHVNGF
LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR
AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD
LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT
QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL
PAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAASKEEAGIIRMLEFGS
HLDLERMQATLPLDNISYRRESAI
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcacgggcacagccgcaacgggcaggcccacgtgccccggcggaaacgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtctacttcgccaacctgagcaacaagtcgcag
cgctacatggcagacatcttcaccacctgtgtggacacgcgttggcgctacatgctcatg
atcttctccgcggccttcctcgtctcctggctcttcttcggcctcctcttctggtgtatt
gccttcttccacggtgacctggaggtcagcccggcggtgcccgcagcaggagccccggcg
ggcagcggcggggcggcccccgtggcccccaagccttgcatcatgcacgtgaacggcttt
ctgggcgccttcctgttctcggtggagacgcagacgaccatcggctatgggttccggtgc
gtgacagaggagtgccctctggccgtcattgccgtggtggtccagtccatagtgggctgc
gtcatcgactccttcatgatcggcaccatcatggctaagatggctcgccccaagaagcgg
gcacagacactgctgttcagccaccacgcggtcatctcagtgcgagacggcaagctctgc
ctgatgtggcgcgtgggcaacctgcgcaagagccacatcgtggaggcccatgtgcgggcc
cagctcatcaagccctacatgacccaggagggcgagtatctgcccctggaccagcgggac
ctcaacgtgggctacgacatcggcctggaccgcatcttcctggtgtcacccatcatcatt
gtccacgagatcgacgaagacagcccactctatggcatgggcaaggaggagctggagtca
gaggacttcgagattgtggtcattctggagggcatggtggaggccaccgccatgaccacc
caggcccgcagctcctacctggccagcgagatcctgtggggccaccgcttcgaacccgtg
gtcttcgaggagaagagccactacaaagtggactactcacgcttccacaagacctacgag
gtggccggcacgccctgctgctccgcccgggagctgcaggagagcaagatcaccgtgctg
cccgccccaccgcccccgcccagtgccttctgctatgagaatgagctggccctcatgagc
caggaggaagaggaaatggaggaggaggctgcagccgctgctgctgtggccgcgggcctg
ggcctggaggcggcctccaaggaggaggcgggcatcatccggatgctggagtttggcagt
cacctggatctggagcgtatgcaagccacgctcccgctggacaacatctcctaccgcagg
gagtccgccatttga

KEGG   Loxodonta africana (African savanna elephant): 100666129
Entry
100666129         CDS       T04351                                 

Gene name
KCNQ1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04725  Cholinergic synapse
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666129 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    100666129 (KCNQ1)
   04972 Pancreatic secretion
    100666129 (KCNQ1)
   04974 Protein digestion and absorption
    100666129 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    100666129 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666129 (KCNQ1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100666129 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 100666129
NCBI-ProteinID: XP_023397355
LinkDB
Position
Unknown
AA seq 1099 aa
MAQENCTLWLQPAPPPAAAGTYPPTSPPSDRRLSDSRSPHSAWYRRGPPSLQMHTEPLLS
AGSTLGWGEGGEELEPYSADQEADRPPGCSVKIWKWLSNAPERPAFFCRPSPAPSVGGAS
SKGSRGSSAGDPRRPRDHPLQSPTLSRPFQGNTRSAAAARSPAARPLPVGRFISPPWLAP
RAPAGTQGSLRPLRLHRDAPSEGGRVGAGALPRLPSRQRGSRPLHLPPVAILRAPLGGPH
PTGPSRWQPEMAYVLGLAPMFSLDPRVSFYRRTTPASDATHFQGRRLNFLERPTGWKCFV
YHFAVFLIVLVCLIFSVLSTIEQYATLAMGTLFWMEIVLVAFFGTEYVVRLWSAGCRSKY
VGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVVRQ
GGNWKLLGSVVFIHPQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALW
WGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHF
NRQIPAAASLIQTAWRCYAAENPESSTWKIYVRKPARNHTLLSSSPKPKKSVMVKKKKFK
LDRDNGVGPGEKTLTVPHITYDPVGDDRRADRLSLDGYDGTVKKSPTLLDVSTTHFMRTN
SFTEDLDLEGETLLVPITHISQLREHHRVTIKVIRRMQYFVAKKKFQVSAYHTPDLDRGP
GHDFCGGPVGALLEASDLPFQAICFPPRRLDQSIGKPSLFISVSEKNKDRGNNTIGARLN
RVEDKVGASVLATVALAGSRAWFLVIAVVGAHTVLTTAASPTPGSVLSVYKRLGWCLWGS
SSFLPPYLLPSFLPSIPSSLHPFLLLDCLRTLGSRTLHPHQPGPRMPATSLPSQEPLPSI
YPGAMGRPGAWEALSQAHWALLPLKSLWSGAGVISPNSESVYTVYLEVSKRLKIEEFGWA
PECGCPRLPGQRLALAHVHRCRRWVGGEQDGARTAAPGTASSKPASPILGSGLPLSIIST
ELAHALTQAVCSLGTVPTSQVGSETQERLRAVGSPHEHPGKAASADGPLPRAGNVAASAT
LRGLGIWGSAHSITGRAAL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggcccaggagaactgcaccctctggctgcagcctgcccccccacccgctgccgcaggg
acctacccccccacctccccgccctccgaccgtcgcttaagcgactccaggagtccccac
agtgcctggtacaggcggggacccccttctctgcagatgcacacggagccgctgctgagt
gcaggcagcaccctggggtggggagagggtggggaggagctggagccctactctgcagat
caagaagctgaccgcccaccggggtgctcagtgaagatctggaagtggctgagcaatgcc
ccagaaagaccagccttcttttgccgcccttcccccgccccatcagtagggggagccagt
agcaagggcagcaggggcagcagcgcaggggacccgcgcagacctcgggaccacccactg
cagtcgcccacgctgtcccgccccttccaggggaacacacgaagcgcagcggcagccagg
tctcccgcggcccgacccctgcctgtgggccgcttcatctcgcccccctggttggccccc
cgcgccccggccggcacccaagggtcgctcagaccgctcaggctgcaccgggacgctccc
tccgagggtgggagagtgggtgcgggcgccctaccccgcctcccatctaggcagcgcggt
tctcggcctctgcacctgccgcccgtagctatccttcgcgccccgctagggggtccgcac
cccaccgggccaagcaggtggcagcccgagatggcatatgtgctaggtctggcgcctatg
ttcagcctggacccgcgagtttccttctacagacgcaccacgcccgctagtgatgccacc
cacttccaaggccggcgtctcaacttcctcgagcgccccacaggctggaagtgcttcgtc
taccactttgccgtcttcctcatcgtcctggtctgcctcatcttcagcgtgctgtctacc
attgagcagtacgccactctggccatggggaccctcttctggatggagatcgtgctggtg
gcgttctttggcacagagtacgtggtgcgcctctggtcggccggctgccgcagcaagtat
gtgggcatctgggggcggctgcgctttgcccggaagccaatttccatcatcgacctcatc
gtggtggtggcctccatggtggtcctctgtgtgggctccaaaggacaggtgtttgccacc
tcagccatcaggggcatccgcttcctgcagatcctgaggatgctgcacgtggtccgccag
ggtggcaactggaagctgctgggctccgtggtcttcatccacccccaggagctgatcacc
accctgtacatcggctttctgggcctgatcttctcgtcctacttcgtgtacctggccgag
aaggacgccgtgaacgagtcaggccgcgtggaattcggcagctatgctgacgcgctgtgg
tggggcgtggtgacagtcaccaccatcggctacggggacaaggtgccgcagacttggatc
ggcaagaccatcgcctcctgcttctctgtctttgccatctccttctttgcgctccctgcg
ggcatcctgggctctgggttcgccctgaaggtccagcagaagcagcggcagaagcacttc
aaccggcagatcccagcagccgcctcacttatccagactgcgtggaggtgctacgcggct
gagaaccccgagtcctccacctggaagatctacgtgcgcaagcccgcccgcaaccatacc
ctgctctcctccagccccaagcccaagaagtccgtcatggtcaaaaaaaagaaattcaag
ctggaccgggacaacggggtgggccctggggagaagacgctcacggtcccgcacatcacc
tacgacccagtcggggatgatcgcagggctgaccgcctgtccctcgatggctacgacggt
actgtgaagaagagccccacactgctggatgtgagcacaacccacttcatgcggaccaac
agcttcaccgaggacctggacctggagggggagacgctgttggtgcccatcacccacatc
tcacagctccgggagcaccatcgggtcaccatcaaggtcatccgacgcatgcagtacttt
gtggccaagaagaaattccaggtgagtgcataccacacccctgacctagacaggggccct
ggacatgacttctgtggggggccagtgggggcacttctggaagcctcagatttgcccttc
caagctatctgttttcctccccgcaggctggaccagtccatcgggaagccctccctgttc
atctccgtctcagaaaagaacaaagaccgtggcaacaacacaatcggcgcccgcctaaac
cgagtggaagacaaggtaggtgcgagcgtcctggccacagtggctctggcaggcagcaga
gcgtggttcctcgtgattgctgttgttggcgcccacacagtgctgaccacagcagcgtct
cccactcctggttctgtcctgagtgtgtacaagagacttggatggtgcctatgggggtct
tcttccttccttcctccctacctccttccatccttcctcccttccatcccttcctccctc
catcccttccttctcttggactgcctgcgcaccctcggctccaggaccctccacccacac
caaccaggccccaggatgcccgccaccagccttccctcccaggagccccttcccagcatc
tatccaggagccatgggaaggcctggggcctgggaggccctttctcaggcccactgggcg
ctgctgcctttgaagtctctgtggtctggagcgggcgttatctcgccaaacagcgagtct
gtctacacagtttatctggaagtatccaagaggctaaaaatagaggaattcggttgggcc
ccagagtgcggctgccctcggttgcccgggcaacgcctggctctggcccacgtccaccgt
tgccgccgctgggtgggcggggagcaggacggtgcacgcaccgctgctcctgggacagcc
agctccaagcctgccagccccatcctggggtctggcctccctctgtccatcatcagcaca
gagctggcacacgcccttacccaggcagtgtgttccctggggaccgtccccaccagccag
gtgggatctgagacccaggagagactccgggctgtgggctcaccccatgaacaccctggc
aaggcagcctctgctgatgggcctctgcccagagctgggaatgtggcagcctctgccaca
ctgcgtgggctgggcatctggggctctgcccacagcatcacaggacgggctgccctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100666444
Entry
100666444         CDS       T04351                                 

Gene name
KCNQ3
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 3
  KO
K04928  potassium voltage-gated channel KQT-like subfamily member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100666444 (KCNQ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666444 (KCNQ3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100666444 (KCNQ3)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd Ion_trans Ion_trans_2 Lig_chan
Other DBs
NCBI-GeneID: 100666444
NCBI-ProteinID: XP_003408235
LinkDB
Position
Unknown
AA seq 872 aa
MGLKARRAAGAAGGGDDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDVEQVTLALGAG
ADKDGTLLLEGGGRDEGLRRTPQGIGLLAKTPLSRPAKRNNAKYRRVQTLIYDALERPRG
WALLYHALVFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGC
CCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRM
DRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQ
EQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESIVSFPFFRKEQLEGVA
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPVTEDKGYGNDFLIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQARIDMIFTPGPPSTPKHKKSQKGTAFTYPSQQSPR
NEPYVARASTSEVEDQSMMGKFVKVEKQVHDMGKKLDFLVDMHMQHMEQLQVQVMDDYPT
KGPSSPADVDKKEENRYSDLKTIICNYSQTGPPEPPYSFHQVPIDKVGPYGFFAHSPVNL
PQGGPSSGKIQAALPSTATTYAERPTVLPILTLLDSRVNYHSQAELHGPVSDHISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYMFGPSGGSGWMWEKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSIWTPSNKPT
NT seq 2619 nt   +upstreamnt  +downstreamnt
atggggctcaaggcgcgcagggcggcgggggcggctggcggcggcgacgacgggggcggc
ggaggcggcggggccgctaaccccgccggtggggatgcggcggcggccggcgacgaggag
cggaaagtggggctggcgcccggcgacgtggagcaagtcaccttggcgctcggagctggc
gctgacaaagacgggaccctgctcctggagggcggcggccgagacgaggggctgcggagg
accccccagggcatcgggctcctggccaagaccccattgagccgcccggccaagaggaac
aacgccaagtaccggcgcgtccaaactttgatctacgacgccctcgagagaccgcggggc
tgggcgctgctctaccacgcgctggtgttcctgatcgtcctggggtgcttgatactggcg
gtcctgaccacattcaaggagtacgagaccgtctcgggggactggctgctcttactggag
acatttgctattttcatcttcggagccgagtttgctttgaggatctgggctgccggatgt
tgctgccgatacaaaggctggcggggacgcctgaagttcgccaggaagcccctgtgcatg
ctagacatctttgtgctgattgcctctgtgccggtggttgccgtgggaaaccagggcaat
gtcctggccacctccctgagaagcctgcgcttcctgcagatcctgcgcatgctgcggatg
gaccggcggggcggcacgtggaagctcctgggctccgccatctgtgcgcacagcaaagag
ctcatcaccgcctggtacatcgggttcctcacactcatcctttcttcatttcttgtctac
ctggtcgagaaagacgtgcctgaggtggatgcacagggagaagagatgaaagaggagttc
gagacctatgcagatgccctctggtggggcctgatcacactggccaccattggttatgga
gacaagacgcccaaaacatgggagggccgtctgattgcagccaccttttccttaattggt
gtttccttttttgcccttccagcgggcatcctggggtccgggctggcactcaaggtgcag
gagcagcaccgccagaagcactttgagaaaaggaggaagccggctgccgagcttattcag
gctgcctggaggtattatgctaccaaccccaacaggatcgatcttgtggcgacctggagg
ttttatgaatcaatcgtctcttttccattcttcaggaaagaacagctggaaggagtagcc
agccaaaagctgggtctcttggatcgggttcgcctttctaatcctcgtggtagcaatact
aaaggaaagctatttacccctctgaatgtagatgccatagaagaaagtccttctaaagaa
ccaaagcctgttggcttaaacaataaagagcgtttccgcaccgccttccgcatgaaagcc
tacgctttctggcagagttctgaagatgcagggacaggtgatcctgtgacggaagacaag
ggctacgggaatgacttcctcattgaagacatgatccccaccctgaaggctgccatccga
gcagtcagaattctccagttccgtctctataagaaaaaattcaaggagactctgaggcct
tacgacgtgaaggatgtgatcgagcagtactccgcaggacatcttgacatgctttccagg
ataaagtaccttcaggcgagaatagatatgattttcacccctggacctccatctactcca
aaacacaagaagtctcagaaggggacagccttcacctacccatcccaacagtctcccagg
aatgaaccatatgtagccagagcatccacatcagaagttgaagaccaaagcatgatggga
aaatttgtaaaagtagaaaaacaggttcatgacatggggaagaagctcgatttcctcgtg
gacatgcacatgcaacacatggagcagctgcaggtccaagtcatggatgactacccaacc
aaggggccctcctcgccagctgatgtggacaagaaagaggagaacaggtactccgatttg
aaaaccatcatctgcaactattctcagacaggcccccctgagcccccctacagcttccac
caggtgcccatcgacaaagtcggcccctatgggttttttgcacacagcccagtgaacctg
ccccaagggggacccagttctggaaagattcaggcggccctcccttccacagcaacgaca
tatgcagaaagacccaccgttctgcctatcttgactcttctcgactctcgagtgaactac
cactcccaggctgaactgcacggccccgtctccgaccacatctccccccggcagagacgc
agcatcacacgggacagcgacacccccctgtccctcatgtccgtcaaccacgaggagctg
gaacggtctccgagtggcttcagcatctcccaggacagagacgattacatgtttggcccc
agcggggggtcaggctggatgtgggagaagcggtacctcgccgagggtgagacagacact
gacacagaccccttcacgcccagcggctccatgcctctgtcctccacgggggacggcatt
tctgattcgatatggaccccttccaacaagcccacttaa

KEGG   Loxodonta africana (African savanna elephant): 100666683
Entry
100666683         CDS       T04351                                 

Gene name
KCNJ12
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 12
  KO
K05005  potassium inwardly-rectifying channel subfamily J member 12/18
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100666683 (KCNJ12)
  09156 Nervous system
   04725 Cholinergic synapse
    100666683 (KCNJ12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666683 (KCNJ12)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100666683 (KCNJ12)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 100666683
NCBI-ProteinID: XP_003420700
LinkDB
Position
Unknown
AA seq 477 aa
MVWCVAPTDPDLLSLISVAGVPPALLPRAGPGVCQGPPSPGMTAASQANPYSIVSSEEDG
LHLVTMSGANGFGNGKVHTRRRGRPRFVKKSGQCNIEFANMDEKSQRYLADMFTTCVDIR
WRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAVAEGHGRTPCVLQVHGFMAAFLFS
IETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCVIDSFMIGAIMAKMARPKKRAQTLLFS
RHAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDK
GLDRIFLVSPITILHEIDEASPLFGLSRQDLETDDFEIVVILEGMVEATAMTTQARSSYL
ASEILWGHCFEPVLFEEKNQYKIDYAHFHKTYEVPSTPRCSAKDLVENKFLLPSAGSFCY
ENELAFLSRDEEDEEGGDQDACSQDGLSPQNRHEFDRLQAGGGSGLEQRPYRRESEI
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggtgtggtgtgttgcccccaccgaccctgacctgctgtctctcatctctgttgcaggc
gtccctccagccttgttgcctagagctggcccgggggtgtgccagggcccccccagcccg
ggaatgactgcagccagccaggccaacccctatagcattgtgtcatctgaggaggacggg
ttgcacctggtcaccatgtcgggtgccaacgggtttggcaacgggaaggtgcacacacgt
cgccggggccgtccccgcttcgtcaagaagagcggtcagtgcaacatcgagttcgctaac
atggacgagaagtcacagcgctacctggctgacatgttcaccacctgcgtggacatccgc
tggcgctacatgctgctcatcttctcactggccttcctcgcctcctggctgctgtttggc
atcatcttctgggtaatagccgtggcacatggcgacctggagccagcggtggccgagggc
catgggcgcaccccctgcgtgctgcaggtgcacggctttatggcagccttcctcttctcc
attgagacacagaccactatcggctacgggctgcgctgtgtgacggaggaatgtcccgta
gccgtcttcatggtggtggcacagtccatcgtgggctgtgtcatcgactccttcatgatc
ggcgccatcatggccaagatggcacggcccaagaagcgggcacagacgctgttgttcagc
cgccacgccgtggtggctctgcgtgacggcaagctctgcctcatgtggcgcgtgggcaac
ctacgcaagagccacattgtggaggcccacgtgcgggcccagctcatcaagccacgggtc
acggaggagggtgagtatatcccgctggaccagatcgacattgatgtgggcttcgacaag
ggccttgaccgcatcttcctggtctcgcctatcaccatcctacacgagatcgacgaggcc
agcccgctgtttggcctcagccggcaggacctagagacagacgactttgagatcgtggtc
atcctggagggcatggtggaggccacggccatgaccactcaggcccgcagctcctacctg
gccagtgagatcctctggggccactgctttgagccggtgctctttgaggagaagaaccag
tacaagatcgactatgcgcacttccacaagacctacgaggtgccctccacaccccgctgc
agtgccaaggacctggtggagaataagttcttgttgcccagtgctggctccttttgctat
gagaacgagctggccttcctgagccgcgatgaggaggatgaggagggtggagatcaggat
gcctgcagccaggatggcctcagtccccagaacaggcacgagtttgacaggctgcaggca
ggtgggggcagtggccttgagcagcggccctacagacgggaatcagagatctga

KEGG   Loxodonta africana (African savanna elephant): 100673400
Entry
100673400         CDS       T04351                                 

Gene name
KCNQ4
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 4
  KO
K04929  potassium voltage-gated channel KQT-like subfamily member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100673400 (KCNQ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673400 (KCNQ4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100673400 (KCNQ4)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 100673400
NCBI-ProteinID: XP_003415374
LinkDB
Position
Unknown
AA seq 537 aa
MHHRAGGLGGSNGSGDIPGPGELYDHDANRFLLVFSCLVLSVLSTIQEHQELANECLLIL
EFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQG
NIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFL
VYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPA
GILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSRAYLTATWYYYDSILPS
FRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHRPGSTSFCPGESSRMG
IKDRIRMSSSQRRLGPSKQHLAPPPMPTSPSSEQVGEATSPTKVQKSWSFNDRTRFRASL
RLKARASAEEGPSEDVAEEKSYQCELTVDDVMPAVKTVIRSVRILKFLVAKRKFKETLRP
YDVKDVIEQYSAGHLDMLGRIKSLQARARTEPQAPPRGRCGGWVSGLSEASGLQRPA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcaccatagagctggaggcctgggtggcagcaacggctctggggatatccctggacct
ggggaactctacgaccatgatgctaatagatttttgctggtcttcagctgcctggtgctg
tccgtgctgtctaccatccaggaacaccaggaacttgccaatgagtgtctcctcatcttg
gagtttgtgatgatcgtggtgttcggccttgagtacatcattcgcgtctggtcggctggg
tgctgctgccgttaccgaggatggcaaggccgcttccgctttgccagaaaacccttctgc
gtcatcgactttatcgtgttcgtggcctcggtggccgtcatcgccgcgggcacccagggc
aacatctttgccacgtctgcgttgcgcagcatgcgcttcctgcagatcctgcgcatggtg
cgcatggaccgccgtggcggcacctggaagctgctcggctctgtggtctacgcgcacagc
aaggagctgatcaccgcctggtacatcgggttcctggtgctcatcttcgcctcctttctg
gtctatctggccgagaaggacgctaactccgacttctcctcttacgccgactcgctctgg
tggggcacgattactctgacgacaattggctatggtgacaagacgccgcatacatggctg
ggtagggtcctggctgctggctttgccttactgggcatctccttcttcgccctgcctgcc
ggcattctgggctccggatttgccctgaaggtccaggagcagcaccggcagaagcatttc
gagaagcggaggatgccagctgccaacctcatccaggctgcatggcgactgtactccacc
gacactagccgggcctacctgacggctacctggtactactacgacagtatcctcccatcc
ttcagagagctggccctcttgtttgagcacgtgcaacgggcccgcaatgggggcctacgg
cccctggaggtgcggcgggcgccggtacctgatggagcaccctcccgctacccgcccgtt
gccacctgccaccggccgggcagcacctccttctgccctggggaaagcagccggatgggc
atcaaagaccgcatccgcatgagcagctcccagcggcggttgggcccctccaagcagcac
ctggcacctccaccaatgcccacctccccgagcagcgaacaggtgggcgaggccaccagc
cccaccaaggtgcagaagagctggagcttcaacgaccgcacccgcttccgggcctcgctg
agactcaaagcccgtgcctctgctgaggagggcccctcagaagatgtggcagaggagaag
agctaccagtgtgagctcacagtggatgacgtcatgccagccgtgaagacggtcatccgc
tctgtcaggatcctgaagttcctggtggccaaaaggaaattcaaggagacgctgcggccg
tacgacgtgaaggacgtcattgagcagtactcggcagggcacctggacatgctgggccgg
atcaagagcctgcaggctcgcgcccgaacggagccccaagcgccccctaggggccgctgt
gggggctgggtttctggcctgagcgaggcctctggtttacagcgaccggcttag

KEGG   Loxodonta africana (African savanna elephant): 100677534
Entry
100677534         CDS       T04351                                 

Gene name
KCNJ14
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100677534 (KCNJ14)
  09156 Nervous system
   04725 Cholinergic synapse
    100677534 (KCNJ14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100677534 (KCNJ14)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100677534 (KCNJ14)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 100677534
NCBI-ProteinID: XP_003406581
LinkDB
Position
Unknown
AA seq 421 aa
MGLARALRRLSGALESGDSRAGDEEEARPGLCRNGWAPAASPVGRRRGRFVKKDGHCNVR
FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPP
PPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG
AVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT
PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVI
LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS
AKELDERAEQASHSPKSSFPGSLAAFCYENELALSWCQEEEEEEEAKEGDGAEAEDGTAS
H
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggcctggccagggccctgcgccgcctgagcggcgccctggagtcaggggacagccgg
gctggcgatgaggaggaggcccggccggggctgtgccgcaacgggtgggcgccggcggcg
tctccagtgggccggcgccgtgggcgcttcgtcaagaaggacggccactgcaacgtgcgc
ttcgtaaacctgggcggccagggcgcgcgctacctgagcgacctgttcaccacgtgcgtg
gacgtgcgctggcgctggatgtgcctgctcttctcctgctccttccttgcctcctggctg
ctcttcggcctggccttctggctcatcgcctcgttgcacggcgacctggctgcgccgccg
ccgcccgcgccctgcttctcgcaagtggccagcttcctagccgccttcctcttcgcgctg
gagacgcagacgtccatcggctacggcgtgcgcagcgtcaccgaggagtgcccggccgcc
gtggctgccgttgtgttgcagtgcatcgccggctgcgtgctcgacgccttcgtcgtgggc
gccgtcatggccaagatggccaagcccaagaagcgcaacgagacgctcgtcttcagcgag
aacgccgtcgtggcactccgcgaccaccggctctgcctcatgtggcgcgtcggcaacctc
cgtcgcagccacctcgtcgaggcccacgtgcgggcccagctgctgcagccccgtgtgacc
ccggagggtgaatacatcccactggaccaccaggacgtggacgtgggcttcgatggtggc
accgatcgcatctttctcgtgtctcccatcaccatcgtgcatgagatcgactctgccagt
cccctgtacgagcttggccgtgcggagctggcccgggctgactttgagctggtggtcatt
cttgagggcatggtagaggctacagccatgaccacacagtgccgctcctcctacctccct
ggtgagctgctctggggccatcgttttgagccagtcctcttccagcgtggctcccagtat
gaggtcgactatcgtcacttccatcgcacttatgaggtcccagggacgcctgtctgtagc
gcgaaggagctggatgaacgggcagagcaggcatcccacagccctaagtctagcttccct
ggctccctggctgcattttgttatgagaacgaactggctctgagctggtgccaggaagaa
gaggaagaagaggaggccaaggaaggggatggggcagaggcagaagatgggactgccagt
cactga

DBGET integrated database retrieval system