KEGG   Loxodonta africana (African savanna elephant): 100659125
Entry
100659125         CDS       T04351                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04144  Endocytosis
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04540  Gap junction
lav04630  JAK-STAT signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659125 (EGFR)
   04012 ErbB signaling pathway
    100659125 (EGFR)
   04014 Ras signaling pathway
    100659125 (EGFR)
   04015 Rap1 signaling pathway
    100659125 (EGFR)
   04630 JAK-STAT signaling pathway
    100659125 (EGFR)
   04066 HIF-1 signaling pathway
    100659125 (EGFR)
   04068 FoxO signaling pathway
    100659125 (EGFR)
   04020 Calcium signaling pathway
    100659125 (EGFR)
   04072 Phospholipase D signaling pathway
    100659125 (EGFR)
   04151 PI3K-Akt signaling pathway
    100659125 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100659125 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100659125 (EGFR)
   04520 Adherens junction
    100659125 (EGFR)
   04540 Gap junction
    100659125 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100659125 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100659125 (EGFR)
   04915 Estrogen signaling pathway
    100659125 (EGFR)
   04921 Oxytocin signaling pathway
    100659125 (EGFR)
   04926 Relaxin signaling pathway
    100659125 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100659125 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659125 (EGFR)
   05206 MicroRNAs in cancer
    100659125 (EGFR)
   05205 Proteoglycans in cancer
    100659125 (EGFR)
   05230 Central carbon metabolism in cancer
    100659125 (EGFR)
   05231 Choline metabolism in cancer
    100659125 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100659125 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659125 (EGFR)
   05212 Pancreatic cancer
    100659125 (EGFR)
   05225 Hepatocellular carcinoma
    100659125 (EGFR)
   05226 Gastric cancer
    100659125 (EGFR)
   05214 Glioma
    100659125 (EGFR)
   05218 Melanoma
    100659125 (EGFR)
   05219 Bladder cancer
    100659125 (EGFR)
   05215 Prostate cancer
    100659125 (EGFR)
   05213 Endometrial cancer
    100659125 (EGFR)
   05224 Breast cancer
    100659125 (EGFR)
   05223 Non-small cell lung cancer
    100659125 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659125 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100659125 (EGFR)
   05171 Coronavirus disease - COVID-19
    100659125 (EGFR)
   05163 Human cytomegalovirus infection
    100659125 (EGFR)
   05165 Human papillomavirus infection
    100659125 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100659125 (EGFR)
   01522 Endocrine resistance
    100659125 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100659125 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659125 (EGFR)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100659125 (EGFR)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100659125 (EGFR)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100659125 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100659125 (EGFR)
  Exosomal proteins of bladder cancer cells
   100659125 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 100659125
NCBI-ProteinID: XP_010585451
LinkDB
Position
Unknown
AA seq 1205 aa
MRPSGAVGATLLVLLATHFQASWALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNLLYENTYALA
VLSNYGANKTGVKELPMRNLQEILTGAVRFSNNPVLCSIETIQWRDIVDSDFISNMSMDL
QSSQASCQKCAPSCPNGSCWGTGEENCQKLTKTICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLICRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPHNYV
VTDHGSCVRSCGSDSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFKGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPVNKTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRKLCYANTINWKKL
FGTSRQNTKIINNRGEKDCKAVGYVCNPLCSSEGCWGPEPKDCVSCRNVSRGRECVNKCN
ILEGEPREFVEKSECIQCHPECLPQPMNITCTGRGPDSCIKCAHYIDGPHCVKTCPSGIL
GENNTLVWKYADASHVCHLCHPNCTFGCAGPGLEGCATNGPKIPSIATGIVGGLLLLVVM
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPVTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPVCTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMNLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQ
QGFFNSPSTSRTPLLNSLSAASNNSTVACVDRNGQSSPIKEDSFLQRYSSDPTGALTEES
IDDSFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVENPEYLNT
TEPACVNSPAYWAQKGNHQISLDNPDYQQDFFPKEAKPNGIFKVPAAENAEYLRVAPPSS
EFIGA
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgcgaccctccggggcagtcggtgccacgctcctggtgctgctggctacgcacttccag
gcgagttgggcgctggaggaaaagaaagtttgccagggcacgagcaacaagcttactcag
ttgggcacttttgaagatcactttctgagcctccagaggatgttcaataactgtgaagtg
gtccttgggaatttggaaattacctacgtgcaaaggaattatgacctgtccttcttaaag
accatccaggaggtcgccggctatgtactcattgccctcaacacagtggagaggattccc
ttggaaaacctgcagattatcagaggaaatctactctatgaaaacacctatgccttggcc
gtcttatccaactatggtgcaaataaaaccggagtaaaggagctgcccatgaggaactta
caggaaatcctgactggtgccgtgagattcagcaacaaccctgtcctctgcagcatagaa
accatccagtggcgagacattgtcgacagtgatttcataagcaatatgtcaatggacttg
cagagcagtcaggccagctgccagaagtgtgctccaagctgtcccaatggaagctgctgg
ggtacgggagaggaaaactgccagaaattgaccaaaaccatctgtgcccagcagtgttct
gggcgctgccgcggcaagtcccccagcgactgctgccacaaccagtgtgccgccggctgc
acaggaccccgagagagtgactgtctgatctgccgaaagtttcgagatgaagccacatgc
aaggacacttgcccgccactgatgctctacaaccccaccacataccagatggatgttaac
ccagagggaaaatacagctttggcgccacatgtgtgaagaagtgcccacataactatgtg
gtgacagaccacgggtcgtgtgtccggtcctgcggttccgacagctatgagatggaggag
gatggagtccgcaagtgtaaaaagtgtgaggggccttgtcgcaaagtttgtaatggcatt
ggaattggtgagtttaaagacacactttccataaatgctacaaatattaaacacttcaga
aattgcacctctatcagtggagaccttcatatcctcccagtagcatttaagggtgactcc
ttcacacgcactccacctctagatccaaaggaactggatattctaaaaaccgtaaaagaa
ataacagggtttttgctgattcaggcttggcctgtaaacaagactgacctccacgctttt
gagaacctagaaatcatacgcggcagaacaaagcaacatggtcagttttctcttgcggtt
gttggcctggacataacgtctttgggattacgctctctcaaggaaataagtgatggagac
gtgataatttcaggaaaccgaaaactgtgctatgcaaatacaataaactggaaaaaacta
tttgggacttcaagacagaacaccaaaattataaacaacagaggcgagaaggactgcaag
gccgtaggctacgtttgtaatcccttgtgctcatcagagggctgctggggcccggaaccc
aaagactgcgtctcctgccgcaatgtcagccgaggccgagagtgtgtgaacaagtgcaat
attctggagggagagccgagggagtttgtggagaaatccgagtgcatacagtgccatcct
gaatgtctgccccagcccatgaatataacctgcacgggacgcggacctgacagctgtata
aagtgtgcccactacatcgacggcccccactgtgtcaagacctgcccatcagggatcctg
ggagaaaacaacaccctggtctggaagtatgcggatgccagtcacgtgtgccacctgtgc
catccaaactgcactttcggctgtgctggaccaggtcttgaaggctgtgcaacgaatggg
cccaagatcccatccatcgccactggaattgtgggtggcctcctcttgttggtggtgatg
gctcttgggattggccttttcatgcgaaggcgccacattgtccggaagcgcacgctgcgc
agactgctgcaggaaagagagctcgttgagccagtgacgcccagtggtgaagctcccaac
caagctctcctgaggatcttaaaggaaacagaatttaagaagatcaaagtgcttggctct
ggggcctttggcactgtgtataagggactctggatcccagaaggagagaaagttaaaatt
cctgtggctatcaaagaattaagagaagccacgtctccaaaagccaacaaagagattctt
gacgaagcctatgtcatggccagtgtggacaatcctcacgtgtgccgcttgctgggtatc
tgtctgacctccacggtccagctcatcacacagctcatgccctttggctgcctcctggac
tatgtccgcgagcacaaggacaacatcggctcccagtacctcctcaactggtgtgtgcag
attgcaaagggcatgaactacctggaagaccgccgcctggtgcaccgcgacctggctgcg
agaaatgtcctggtgaagactccgcagcacgtcaagatcacagatttcgggctggccaaa
ctgcttggtgctgaagagaaggagtaccatgctgaaggaggcaaagttcctattaaatgg
atggctctggaatcaattttacaccgaatttatacccaccaaagtgatgtctggagctac
ggtgtcacagtttgggagttgatgacctttggatccaagccttatgatggaatccctgca
agtgagatctcgtccatcctagagaaaggagagcgccttccgcagccacccgtgtgcacc
atcgatgtgtacatgatcatggtcaagtgctggatgatagatgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgtgaccctcagcgctaccttgtc
attcagggagatgaacgaatgaatctgcccagccctacagactcaaatttttaccgtgcc
ctgatggacgaagaggacatggaagatgtcgtggacgcagacgagtacctcattccacag
caaggattcttcaacagtccttctacatctcgaactcccctcctaaattctctgagcgca
gccagcaacaattccacggtggcttgcgttgatagaaacgggcagagcagtcccatcaag
gaggacagcttcctgcagcggtacagctctgaccccacaggagccttgactgaagagagc
atcgatgacagcttcctgccagtgccagaatacataaaccagtctgttcccaaaaggccc
gcgggctctgtccagaatcccgtctaccacaatcagcctctgaatccagcccccggcaga
gaccctcactaccaaaacccccacagcaatgccgtggagaaccccgagtatctcaacacc
accgagcctgcctgtgtcaacagccccgcctactgggcccagaaaggcaaccaccaaatc
agtctggacaaccccgactaccaacaggacttcttcccgaaggaagccaagccaaacggc
atcttcaaggttcccgcagctgaaaatgctgaatacctaagggttgcaccaccaagcagt
gagtttattggagcctga

DBGET integrated database retrieval system