KEGG   Loxodonta africana (African savanna elephant): 100659222
Entry
100659222         CDS       T04351                                 

Gene name
DES
Definition
(RefSeq) desmin isoform X2
  KO
K07610  desmin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100659222 (DES)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100659222 (DES)
   05414 Dilated cardiomyopathy
    100659222 (DES)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100659222 (DES)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     100659222 (DES)
SSDB
Motif
Pfam: Filament Filament_head Spc7 GAS DUF4515 Baculo_PEP_C Trimer_CC Jnk-SapK_ap_N TPR_MLP1_2 DUF1664 TolA_bind_tri KASH_CCD CENP-H Patched CENP-F_leu_zip Golgin_A5 Prefoldin TACC_C
Other DBs
NCBI-GeneID: 100659222
NCBI-ProteinID: XP_003406096
UniProt: G3T316
LinkDB
Position
Unknown
AA seq 469 aa
MSQAYSSSQRVSSYRRTFGGGSAFPLGSPLSSPVFPRAGFGTKGSSSSVTSRVYQVSRTS
GGAGGLGSLRASRVGASRTPSYSAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFAN
YIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERD
NLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLSRIDLERRIESLNEEIAFLKK
VHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVS
DLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEAS
GYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQ
TFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagccaggcctactcctccagccagcgcgtgtcttcctaccgccgcaccttcggcggc
gggtcggccttcccgctcggctccccgctgagctcgcccgtgttcccgcgcgcgggcttc
ggcaccaagggctcctcgagctcggtgacgtcgcgcgtctaccaggtgtcgcgcacgtcg
ggcggggctggggggctggggtcgctgcgggccagccgggtgggcgcgagccggaccccc
tcgtacagtgcgggggagctgctggacttctcgctggccgacgccgtcaaccaggagttc
ctgaccacgcgcaccaacgagaaggtggagctgcaggagctcaatgaccgcttcgccaac
tacatcgagaaagtgcgcttcctggagcagcagaacgcggcgctcgcggcggaagtgaac
cggctcaagggccgtgaacccacgcgcgtggccgagctctacgaggaggagctgcgcgag
ctgcggcgccaggtggaggtgctgaccaaccagcgcgcgcgcgtcgacgtcgaacgcgac
aacctcctcgacgacctgcagcggctcaaggccaagctgcaagaggagatccagctgaaa
gaagaagcagagaacaatttggctgccttccgagcggacgtggatgcagccactctatct
cgcattgacctggagcgcagaatcgagtctctcaacgaggagatagcgttcctcaagaaa
gtgcacgaagaggagattcgtgagctgcaggcccagcttcaggagcagcaggtccaggtg
gagatggacatgtccaagccagacctcaccgctgccctcagggacatccgggctcagtat
gagaccatcgcagccaagaacatctctgaagctgaggagtggtataagtcaaaggtgtct
gacctgacccaggcagccaacaagaacaacgacgcactgcgccaggccaagcaggagatg
atggagtaccgacaccagatccagtcctacacctgcgagattgacgccctcaagggcact
aacgattctctgatgaggcagatgcgggagctggaggaccgctttgccagtgaggccagc
ggctatcaggacaacattgcccggcttgaggaggagatccggcacctcaaggatgagatg
gcccgccacctgcgcgagtaccaggacctgctgaacgtcaagatggctctggatgtggag
attgccacctacaggaagctgctggagggcgaggagagccggatcaacctccctatccag
accttctctgctctcaacttccgagaaacaagtcctgagcaaaggggctccgaggtccat
accaagaagacagtgatgatcaagaccattgagacccgggatggggaggtcgtcagtgag
gccacacagcagcaacacgaggtgctctaa

DBGET integrated database retrieval system