KEGG   Loxodonta africana (African savanna elephant): 100659236
Entry
100659236         CDS       T04351                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04072  Phospholipase D signaling pathway
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100659236 (RALGDS)
   04015 Rap1 signaling pathway
    100659236 (RALGDS)
   04072 Phospholipase D signaling pathway
    100659236 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659236 (RALGDS)
   05231 Choline metabolism in cancer
    100659236 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659236 (RALGDS)
   05212 Pancreatic cancer
    100659236 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 100659236
NCBI-ProteinID: XP_003407502
LinkDB
Position
Unknown
AA seq 918 aa
MVQRMWAEEAGPAGSAEPLFPGSRRSRSVWDAVRLELDVPDSCSVVLHSFTHLDPDLPRL
ESSTQEIGEELVNGVIYTISLRKGPVHHAANKGQRWLGYENESALNLYETCKVRAVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFATTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSDEDGGPEDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
ADLLLAQLEHSELTETEPEAPAPVLPPAPELVPAPAPAPEIEPAPVPGSAPELEPAPVLE
LEPASAPALEPAPAPAPVPVHTPASALALSPAPAPALSPVPAPASAPAPAPAPVSELEPA
PASAPEPSCPSPVTTENGLSEEKPNLLAFPPELVAEQFTLMDAELFKKVVPYHCLGCIWS
QRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGDRNMKATDRARVVEHWIEVARECRIL
KNFSSLHAVLSALQSNSIHRLKKTWEEVSRESFRIFQKLSEIFSDENNYSLSRELLIKEG
TSKFATLEMNTRRAQKRQRELGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRMINFEKRR
KEFEVIAQIKLLQSACNNYSIAPEEHFVAWFRAMERLSETESYNLSCELEPPSESASNTL
KAKKNTAIVKRWSDRQAPSTELSTSGSCHSKSCDQLKCGPYLSSGDTAEVLSVHSAGSSS
SDVEEINISFVPESPDCQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVASTRTHK
RSVSGVCNYNSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKH
NLDDDEPDDYELVQIISEDRKLKIPDNANVFYAMNSTANYDFVLKKRTFIKEAKVKHGAS
STLPRMKQKGLKIAKGIF
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggaggccgggcctgcgggcagcgccgagccgctgttt
ccgggctcccggcggagccgtagtgtgtgggacgccgtgcgcctggagctggacgtcccc
gacagctgctcggtggtgctgcacagcttcacgcatctcgaccccgatctgccgcgcctg
gagagctccacgcaggagattggcgaggagctggtcaacggggtcatttacaccatctcc
ctgcgcaaggggccggtgcaccatgccgccaacaaaggccagcgctggcttgggtatgaa
aatgagtcagccctgaacctgtatgagacctgcaaggtgagggcagtcaaggcaggcacg
ctggagaagctagtggaacacctggtgcctgccttccagggcagcgacctctcctacgtc
accatcttcctgtgcacctaccgagccttcgccaccacccagcaggtcctggacctgctg
ttcaaaaggtacggtagatgtgacgccctcacggcctcctctagatacggatgcatccta
ccatattctgatgaggacggcggacccgaggaccaactgaaaaatgccatctcctccatt
ctgggcacctggctggaccagtactctgaagatttctgtcagcccccggacttcccatgc
ctcaagcagctggtggcctatgtgcagctcaatatgcctggttcagacctggaacgccgt
gccgaccttctccttgcccagctggagcactcagaactcactgagacagagccagaggct
ccagcgccagttctacctccagctccagagctagtgccagctccagcaccagctccagaa
atagaaccagctccagtaccaggttcagctccagagttagagccagcaccagttctagag
ctagagcctgcttcagctccagctctagaaccagctccagcaccagctccagttccagtt
cacactccagcttcagccctagctctatctccagctccagctccagctctatccccagtt
ccagctccagcttcagccccagccccagctccagctccagtttcagagctcgagccagca
ccagcttcagcaccagagccttcctgcccatcccctgtgacgacggagaatgggctgagt
gaggagaagcctaacctcctagcattccctccagaactggtggcagagcagtttacactg
atggatgcggagctgttcaagaaggtggtgccctatcactgcctgggctgtatctggtcc
cagcgggacaagaagggcaaggagcacctggcacccaccatccgcgccaccgtcacccag
ttcaacagtgtggccaactgtgtcatcaccacgtgcctgggggaccggaacatgaaggcc
acggacagggctagggtagtggaacactggatcgaggtggccagggagtgccgaatcctc
aagaatttctcatctctccatgctgtcctttccgctctgcagagcaactcgattcaccgt
ctgaagaagacgtgggaagaagtttccagggaaagcttccgaatctttcaaaagctgtct
gagatcttctcagatgagaacaactactcactgagtcgggagctgctcatcaaggagggg
acttccaagtttgccaccctggagatgaacaccaggagagcccagaagcggcagagggag
ttgggtgtcatccagggcaccgttccctaccttggcacgttcctcactgacctggtgatg
ctggacacagcgatgaaggattatctgtatgggagaatgatcaacttcgagaagaggagg
aaggaattcgaagtgattgctcagatcaagctgctccagtcagcctgcaacaattacagc
atcgcccctgaggagcacttcgtggcctggttccgagccatggagcggctcagtgagact
gagagttacaacctgtcctgtgaactggaacccccttctgaatcagccagcaacaccctc
aaggccaagaagaacacggccattgtcaagcgctggagcgaccgccaggcccccagcaca
gagctcagtaccagcggcagctgccactccaagtcctgtgaccagctcaagtgcggcccc
tacctcagcagtggggacacagccgaagtgctcagcgtgcactctgctggctcctccagc
tccgacgtggaagaaatcaacataagctttgtcccggagtcccctgactgccaggaaaag
aagttctgggagtcagcctcccagtcatccccagagacctccggcatcagctcagcctcc
agtagtacctcgtcctcctcggcctccaccacgcccgtggcctccacacgcacccacaag
cgctctgtctcaggggtctgcaactacaactcctcgctgcccctctacaaccagcaggtg
ggcgactgctgcatcatccgtgtcagcctggacgtggacaatggcaacatgtacaagagc
atcctggtgaccagccaagataaggctcctaccgtgatccgcaaggccatggataaacac
aacctggatgacgatgagccagatgactacgagctggtgcagattatctcagaggatcga
aagctgaagatccctgacaacgccaacgtgttctatgccatgaactctaccgccaattat
gactttgtcctaaagaagcgaactttcatcaaggaggcaaaggtcaaacacggggccagc
tcaacccttccacggatgaagcagaagggactcaagattgccaagggcatcttctag

KEGG   Loxodonta africana (African savanna elephant): 100674091
Entry
100674091         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ral guanine nucleotide dissociation stimulator-like
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04072  Phospholipase D signaling pathway
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100674091
   04015 Rap1 signaling pathway
    100674091
   04072 Phospholipase D signaling pathway
    100674091
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674091
   05231 Choline metabolism in cancer
    100674091
  09162 Cancer: specific types
   05210 Colorectal cancer
    100674091
   05212 Pancreatic cancer
    100674091
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 100674091
NCBI-ProteinID: XP_023415102
LinkDB
Position
Unknown
AA seq 566 aa
MFVPSLSHLQREKESVSSLHRKSSVRTYKLFTIETIVEPLVPAFQDNDTSYVSTFLSTYR
SFGTTKQVLEALFKKYGYKLGSDESQDEIKNAISSILGMWLDKYPEDFRELPDFPCLRLL
EDYTGLNMPGSELQERVRLLLAQMEQLEPTEAEPEGDWLRTQGEYSRFWPQTTHVLDCSL
GRLLGRELGLLTRQWHGLYVWKSIWKALVLVKLSLFPAPGPSLELHTTQASAPVAAQELE
TAPLAAPEPAPSPAPAVTPELGPVQAPTPESSCPSLGSTMHGLRGEKPNILSFPPKLVAE
QLTMMDMELFKKVVPYDCLGSIWSQRKKKGNEHLAPTVRATVTQFNSVVHSVITTCLGDR
SMKASDRATVVEHWIEVARECLIHRNFSSLQAILSALQSTSINRLKETWGEVSSHSYQTF
KKLCKKKKMLIRDLPIKGISKFATLEMNPKRAQKGXLQREKGVVQFTVPYLGVYLTDLVM
LDTALQDFLDGGLVNFQKRRKEFSVLQEIKLLQRACQQYTIVAQEQFEAWFQEMERLTET
ESYNLSCELEPRAQLSRNTRLPSKKT
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgtttgtcccttctttgtctcacctccagcgtgaaaaggagtcagtgtccagcctgcat
aggaagtcctcagtgcggacctacaaactatttacgattgaaacaatagtggagcccctg
gtacctgctttccaggacaatgacacctcatacgtctccacctttctgtccacttaccgg
tccttcgggaccaccaaacaggtcttagaggccctcttcaaaaagtacggatacaagctc
gggagtgatgaatcccaggacgaaataaaaaatgccatctcctccatcctgggtatgtgg
ttggacaaatacccagaagatttccgtgagctcccggattttccctgcctccggctgctg
gaagactacacagggctcaatatgcccggatcggaactacaggaacgtgtccgccttctt
ttggcacaaatggaacaactagagcccactgaggcagagccagagggggactggctgcgt
acccagggagaatattccaggttttggcctcagaccactcatgttttggactgcagtcta
ggaaggcttctgggaagagaactggggctgctcacaaggcagtggcatggtttgtatgtt
tggaaaagcatatggaaagcccttgtgttggtgaaactttcactctttccagctccagga
ccatcactggagctacacacaactcaagcatcagctccagtggcagctcaggagctggaa
acagctcctctggcagctccagaaccagctccatcaccagccccagcagttacaccagag
cttgggccagtgcaagctccaacaccagagtcttcctgcccctcacttgggagcacaatg
catgggctcagaggggagaagccaaacatcttgtcattccctcccaagctggtggcagag
caattaacaatgatggatatggagctgttcaagaaggtggtgccctatgactgcctagga
tccatctggtcccaaagaaagaagaagggcaatgagcacctggcgcccaccgtccgggcc
actgtcacacagtttaatagtgtagtacacagtgtcatcaccacctgcctgggggacagg
agcatgaaggcctcagacagggccacagtggtggagcactggattgaggtagccagggag
tgtctgatccacaggaacttctcctcgctccaagctattctctctgctctgcagagcact
tcaatcaatcgtttgaaggaaacatggggagaagtgtccagccacagctatcaaaccttt
aagaagctgtgtaagaagaagaagatgttgatcagggacctgcccattaaggggatctcc
aagtttgccaccctggagatgaaccccaagagagcccagaaggggtagctacagagggag
aagggtgtcgtccagttcaccgtgccctacctgggagtgtacctcacagacctggtgatg
ctggacactgctttacaggatttcctagatggaggtttggtaaacttccaaaaaaggaga
aaggagtttagtgtgctgcaggagataaaactcctccagagggcctgccaacagtacacc
attgtggctcaggaacaatttgaggcctggttccaggaaatggagcgtctcactgagact
gagagctacaacctgtcctgtgagctggagccccgggcacagctatccaggaacacccgc
ttgcccagcaagaagacctag

DBGET integrated database retrieval system