KEGG   Loxodonta africana (African savanna elephant): 100659266
Entry
100659266         CDS       T04351                                 

Gene name
NSF
Definition
(RefSeq) vesicle-fusing ATPase
  KO
K06027  vesicle-fusing ATPase [EC:3.6.4.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04727  GABAergic synapse
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100659266 (NSF)
  09156 Nervous system
   04727 GABAergic synapse
    100659266 (NSF)
   04721 Synaptic vesicle cycle
    100659266 (NSF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100659266 (NSF)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     100659266 (NSF)
Membrane trafficking [BR:lav04131]
 SNARE
  SNARE associated proteins
   Others
    100659266 (NSF)
SSDB
Motif
Pfam: AAA CDC48_N AAA_lid_3 CDC48_2 AAA_22 AAA_16 RuvB_N RNA_helicase AAA_2 AAA_14 AAA_18 AAA_5 AAA_33 TIP49 Mg_chelatase AAA_24 TsaE ATPase_2 NACHT AAA_17 AAA_28 ABC_tran ATPase IstB_IS21 NB-ARC AAA_3 AAA_7 Rad17 DUF1454
Other DBs
NCBI-GeneID: 100659266
NCBI-ProteinID: XP_003414559
LinkDB
Position
Unknown
AA seq 751 aa
MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVVVRTSPNHRYTFTLRTHPSVVPGSI
AFSLPQRKWAGLSIGQEIDVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAE
FIQQFNNQAFSVGQQLVFCFNDKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHHLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLEDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLESLELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALLREEGASPLEFENGLFATH
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggcgggccggagtatgcaagctgcaaggtgtcctacggatgaactatctttaaccaac
tgtgcagtcgtgaatgaaaaggatttccagtctgggcagcatgtggttgtgaggacctct
cccaaccacaggtacacatttacactgaggacccatccatcagtggttccagggagcatt
gcattcagcttaccccagcgaaaatgggctggactctctattggacaagaaatagatgtc
tccttgtatacatttgacaaggccaaacagtgtattggcacaatgaccatcgagattgat
ttcctacagaaaaaaagcatcgactccaacccttacgatactgacaagatggcagcagaa
tttattcaacagttcaacaaccaggctttctcagtgggacagcagcttgtgttttgcttc
aatgataagctttttggcttactggtgaaagatattgaagccatggatcctagcatcctg
aagggggagcctgcgacaggtaaaagacagaagattgaagtaggactggttgttggaaac
agtcaagttgcatttgaaaaagcagaaaattcttcgctcaatctcattggcaaagctaaa
accaaggaaaatcggcagtctatcatcaaccctgactggaactttgaaaaaatgggaata
ggtggcctggacaaggaattttcagatatttttcgacgagcatttgcatcccgagtattt
cctccagagattgtagagcagatgggttgcaaacatgttaaaggcatcctgttatatggg
cccccaggatgtggtaagacccttctggctcgacagattggcaagatgttaaatgcaaga
gagcccaaagtggtcaacggaccagaaatccttaacaaatatgtgggagaatcagaggct
aacattcgtaaactctttgctgatgccgaagaggagcaaaggcggcttggtgctaacagt
ggtttgcacatcatcatctttgatgaaatcgatgccatctgcaagcaaagagggagcatg
gctggcagcacaggagttcatgacactgttgtcaaccagttactgtccaaaattgatggg
gtggagcaactgaacaacatcctagtcattggaatgaccaacagaccagatctgatagat
gaggctctccttcgacctggaaggctggaagttaagatggagataggcttaccggatgag
aaaggtcgactacagatccttcacatccacacagcaaggatgagaggacatcacttactc
tccgctgatgtagatattaaagaactggccgtggagaccaagaatttcagcggtgctgag
ctggagggtctggtgcgagcagcacagtccactgccatgaatagacacataaaggccagt
actaaagtagaagtggacatggagaaagcagagagcctgcaggtgacaagaggagacttc
cttgcttctttggagaatgatatcaaaccagcatttggcacaaaccaagaggattatgca
agttacattatgaatggtatcatcaaatggggcgatccagttactcgggttttggaagat
ggggagctgctggttcaacagactaaaaacagtgaccgcacaccactggttagcgtcctt
ctggaaggccctcctcatagtgggaagactgccttagcggcaaagattgcagaggaatcc
aatttccccttcatcaagatctgttctcctgataagatgattggcttttctgagacggcc
aagtgtcaggccatgaagaagatctttgatgatgcatataaatcccagctcagttgtgtg
gttgtggatgacattgagagactgctcgattatgttcctattggccctcgattttctaat
ctggtgttacaagctcttcttgtgttactgaaaaaggcacctcctcagggccgcaagctt
cttatcattgggaccaccagccgcaaagatgtccttcaggagatggaaatgcttaatgct
ttcagcaccaccatccacgtgcccaacattgccacaggagagcagctgttggagtctttg
gagcttttgggcaacttcaaggacaaggaacgcaccacaattgcacagcaagtcaaaggg
aagaaggtctggataggaatcaagaagttactgatgttaattgagatgtccctacagatg
gatcccgaatatcgtgtgagaaaattcttggccctcttaagagaagaaggagctagccct
cttgaatttgaaaacggactatttgcaacacattga

DBGET integrated database retrieval system