KEGG   Loxodonta africana (African savanna elephant): 100659273
Entry
100659273         CDS       T04351                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04510  Focal adhesion
lav04666  Fc gamma R-mediated phagocytosis
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05211  Renal cell carcinoma
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659273 (CRK)
   04012 ErbB signaling pathway
    100659273 (CRK)
   04015 Rap1 signaling pathway
    100659273 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100659273 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100659273 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100659273 (CRK)
   04062 Chemokine signaling pathway
    100659273 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100659273 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100659273 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100659273 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659273 (CRK)
   05206 MicroRNAs in cancer
    100659273 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100659273 (CRK)
   05211 Renal cell carcinoma
    100659273 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100659273 (CRK)
   05100 Bacterial invasion of epithelial cells
    100659273 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100659273 (CRK)
   05163 Human cytomegalovirus infection
    100659273 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100659273 (CRK)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100659273 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100659273
NCBI-ProteinID: XP_003416856
UniProt: G3T5V2
LinkDB
Position
Unknown
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcaggcaacttcgactcggaggagcggagtagttggtactgggggcggttgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtactgagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgccccccggtgccgccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggcgtgattctcaggcaggaggaggcagagtatgtgcgagccctc
tttgactttaatgggaacgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcccgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

KEGG   Loxodonta africana (African savanna elephant): 100662046
Entry
100662046         CDS       T04351                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04510  Focal adhesion
lav04666  Fc gamma R-mediated phagocytosis
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05211  Renal cell carcinoma
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662046 (CRKL)
   04012 ErbB signaling pathway
    100662046 (CRKL)
   04015 Rap1 signaling pathway
    100662046 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100662046 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100662046 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100662046 (CRKL)
   04062 Chemokine signaling pathway
    100662046 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100662046 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100662046 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100662046 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662046 (CRKL)
   05206 MicroRNAs in cancer
    100662046 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100662046 (CRKL)
   05211 Renal cell carcinoma
    100662046 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100662046 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100662046 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662046 (CRKL)
   05163 Human cytomegalovirus infection
    100662046 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100662046 (CRKL)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100662046 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100662046
NCBI-ProteinID: XP_023415158
LinkDB
Position
Unknown
AA seq 194 aa
MGSVSAPNLPTAEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGR
VGMIPVPYVEKLVRSSLHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSTTPGAAINP
LPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFT
HVKIIDPQNPDENE
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggatctgtatcagcacccaacctgcctacagcagaagaaaacctggaatatgtacgg
actctgtatgattttcctgggaatgatgccgaagacctgccctttaaaaagggtgagatc
ctcgtgatcatagagaagcctgaagaacaatggtggagtgcccggaacaaggatggccgg
gttgggatgatccctgtcccttatgtcgaaaagctggtgaggtcctccctgcacgggaag
catggaaacaggaattccaacagttatgggatcccagaacctgctcatgcatatgctcaa
cctcagaccacaactcctctacctgctgtttccactactcctggggcagccatcaaccct
ttgccatccacacagaatggacctgtctttgcgaaagcaatccagaaaagagttccctgt
gcttacgacaagactgccttggcattagaggttggtgacattgtgaaagtcacaaggatg
aatataaacggccagtgggaaggcgaggtgaatgggcgtaaagggctttttccctttacg
cacgtcaaaatcattgaccctcaaaacccggatgaaaatgagtga

DBGET integrated database retrieval system