KEGG   Loxodonta africana (African savanna elephant): 100659377
Entry
100659377         CDS       T04351                                 

Gene name
PPP1R14A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 14A
  KO
K12328  protein phosphatase 1 regulatory subunit 14A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100659377 (PPP1R14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659377 (PPP1R14A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100659377 (PPP1R14A)
SSDB
Motif
Pfam: PP1_inhibitor
Other DBs
NCBI-GeneID: 100659377
NCBI-ProteinID: XP_003420812
LinkDB
Position
Unknown
AA seq 150 aa
MAAQRLGKRVLSKLQAPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYRGREAEMPDEVNIDELLELESEEERSRKVRGLLKSCSKPTEDFVQELLGKLRGLHK
QPGHHQLSPSGDSDGRSLSPRQDRARPAPP
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcagcgcagcggctgggtaagcgggtgctgagcaagcttcaggctccatcgcgggct
cgcgggccggggggcagccccggggggctgcagaaacggcatgctcgggtcaccgtcaag
tacgatcggcgggagctgcagcggcggctggacgtggagaagtggatcgacgggcgcttg
gaggagctgtaccgcggccgggaagcagagatgcctgacgaggtcaacattgatgaattg
ttggaattagagagtgaagaggagagaagccggaaagtccggggactcctgaagtcctgc
tcgaagcctacagaggacttcgtccaggagctgctggggaagctgcgcggcctccacaag
cagccgggccaccaccagctcagcccttcgggcgactcggatggccgcagcctgagcccc
cgccaggaccgcgcccggcccgcgcccccctga

DBGET integrated database retrieval system