KEGG   Loxodonta africana (African savanna elephant): 100659447
Entry
100659447         CDS       T04351                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05144  Malaria
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659447 (MYD88)
   04064 NF-kappa B signaling pathway
    100659447 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100659447 (MYD88)
   04621 NOD-like receptor signaling pathway
    100659447 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100659447 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100659447 (MYD88)
   05135 Yersinia infection
    100659447 (MYD88)
   05133 Pertussis
    100659447 (MYD88)
   05134 Legionellosis
    100659447 (MYD88)
   05152 Tuberculosis
    100659447 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100659447 (MYD88)
   05161 Hepatitis B
    100659447 (MYD88)
   05171 Coronavirus disease - COVID-19
    100659447 (MYD88)
   05164 Influenza A
    100659447 (MYD88)
   05162 Measles
    100659447 (MYD88)
   05168 Herpes simplex virus 1 infection
    100659447 (MYD88)
   05169 Epstein-Barr virus infection
    100659447 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    100659447 (MYD88)
   05145 Toxoplasmosis
    100659447 (MYD88)
   05140 Leishmaniasis
    100659447 (MYD88)
   05142 Chagas disease
    100659447 (MYD88)
   05143 African trypanosomiasis
    100659447 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 100659447
NCBI-ProteinID: XP_003415803
LinkDB
Position
Unknown
AA seq 314 aa
MAAGAPGPGSAPSAPSVPPAPSASSAPSAPSGSSAPWVPLAALNMRVRRRLSLFLNVQSL
VAADWTTLAEELGFEYLEIRQLEAYPNPTGRLLDAWEGRPDASVSRLLELLAKLGRQDAL
EELGPSIEEDCQKYILKQKQEESEKPLQVPAVDSSVPRTAEVAGITTLDDPLGQVPERFD
AFICYCPSDIQFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVV
VSDDYLQSKECDFQTKFALSLCPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTK
SWFWIRLAKALSLP
NT seq 945 nt   +upstreamnt  +downstreamnt
atggctgcgggagcgcccggcccgggctccgcgccctctgcgccctcggtgccccctgca
ccctctgcgtcctccgcgccctccgcgccctcggggtcctccgcgccctgggtgcccctg
gctgcgctcaacatgcgagtgcggcgccgcctgtcgctgttcctcaacgtgcagtcgctg
gtggcggccgactggaccacgctggccgaggagctgggcttcgagtacctggagatccgg
cagctggaggcgtaccccaaccccaccggccgcctgttggacgcctgggagggccgccct
gacgcctctgtgagccgcctgctcgagctgcttgccaagcttggccgccaggacgccctg
gaagagctggggcccagcatcgaggaggactgccagaaatatattctgaagcagaagcag
gaggagtctgagaagcctctacaggtgcccgccgtggacagcagcgtcccacggacggca
gaggtggcaggcatcaccacgcttgatgatcccctggggcaagtgcccgagcgcttcgat
gccttcatctgctactgccccagcgacatccagtttgtgcaggagatgatccggcagcta
gagcagacagactatcggctgaagttgtgtgtgtctgaccgcgatgtcctgcctggcacc
tgtgtctggtccattgccagcgagctcattgagaaaaggtgtcgccgaatggtggtggtt
gtctctgatgattacctgcagagcaaggaatgtgacttccagaccaagtttgcgctcagc
ctctgtccaggtgcccatcagaagcggctgatccccatcaagtacaaggcaatgaagaag
gagttccccagcatcctgcggttcatcaccgtctgtgactacaccaacccctgcaccaag
tcctggttctggatccgccttgccaaggccctgtccctgccttga

DBGET integrated database retrieval system