KEGG   Loxodonta africana (African savanna elephant): 100659456
Entry
100659456         CDS       T04351                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
lav04514  Cell adhesion molecules
lav04520  Adherens junction
lav05100  Bacterial invasion of epithelial cells
lav05200  Pathways in cancer
lav05213  Endometrial cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100659456 (CDH1)
   04390 Hippo signaling pathway
    100659456 (CDH1)
   04371 Apelin signaling pathway
    100659456 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100659456 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100659456 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659456 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100659456 (CDH1)
   05216 Thyroid cancer
    100659456 (CDH1)
   05218 Melanoma
    100659456 (CDH1)
   05219 Bladder cancer
    100659456 (CDH1)
   05213 Endometrial cancer
    100659456 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100659456 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100659456 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100659456 (CDH1)
   04090 CD molecules [BR:lav04090]
    100659456 (CDH1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100659456 (CDH1)
Cell adhesion molecules [BR:lav04515]
 Cadherins
  Major cadherins
   100659456 (CDH1)
CD molecules [BR:lav04090]
 Proteins
  100659456 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_2
Other DBs
NCBI-GeneID: 100659456
NCBI-ProteinID: XP_003417088
LinkDB
Position
Unknown
AA seq 884 aa
MGPRCCSLFALLLLLQVSAWLCEEPEPCRPGFGAESYVFTVTRRHLERGHVLGRVSFEGC
TGRPRTAYFSEDTRFKVATDGVVTVRWPVQLHNPETSFLVHAWDSTRRKLSTKVTLKVTG
HHRHHQQHHDSLSGPQTEVLMFPDFHHGGLRRQKRDWVIPPISCPENEKGPFPKNLVRIK
SSRDKEIEVFYSITGEGADRPPVGVFVIERKTGWLKVTRPLDREQISNYTLLSHAVSSNG
DAVEDPMEIVITVTDQNDNKPVFTQAVFQGSVMEGAVPGTSVMQVTATDADDDVNTYNAA
IVYTIENQEPTLPHDNMFTINRDTGVISVVTSGLDRESVPKYTLVVKATDLQGLGLSTSA
TAMITVRDNNDNPPIFNPTMYEGTVPENKANADITRLKVTDADVPDTPAWKAKYNILNDN
EKQFVVITDPVTNEGILRTAKGLDFEAKQQYILYVTAENEVPFVVSLSTSTATVTVDVID
VNEAPIFMPPIKRVEVPEDFGVGQEITSYTAQDPDKFMQQKITYRIWRDTANWLEINPDT
GAISTRAELDREDLEHVKNSTYTALIIATDDGSLPATGTGTFILILSDVNDNAPIPDPRS
MDFCQVDPQPHTIYIIDPDLPPNTSPFTAELMYGASVNWSIEYKDAARESLLLMPKVRLE
LGDYKVHLKLTDNQNKDQVTTLDVFMCDCEGAVNTCKRHMPIANAGLPVSAVLGILGGIL
ALLILILLLLLFLRRRRVVKEPLLAPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVIRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgggccctcggtgctgcagcctcttcgcactcctgctgctgctacaggtttcggcgtgg
ctctgtgaggagccggagccctgccgtcctggctttggggcggagagctacgtgttcacg
gttacccggcggcacttggagagaggtcacgtcctgggcagagtgagctttgaaggatgc
actggtcgaccaaggacagcctatttttctgaagacacccgattcaaagtggccacagat
ggtgtggttacggtcagatggcctgtacaacttcataatccagagaccagctttcttgtc
catgcctgggactccacccgcagaaagctttccaccaaagtgacactgaaggtcactggg
caccaccgacaccaccaacagcatcatgactctctctctggaccccagacagaagtgctc
atgtttcccgacttccatcatgggggtctccgaagacagaagagagactgggttatccct
cctattagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcggatcaaa
tctagcagggacaaagaaattgaggttttctacagcatcactggtgaaggagctgataga
cctcctgtcggtgtgttcgttattgaaagaaaaacaggatggctgaaggtgacgcggcct
ctggatagagaacaaatttccaattacactctcttgtctcatgctgtgtcatcaaatgga
gatgcagtcgaagacccaatggagattgtgattaccgtgacagatcagaacgacaataag
cccgtattcacccaggctgtctttcaagggtctgtcatggaaggcgctgtcccaggaacc
tcagtgatgcaggtcacagccacagacgcggatgacgatgtgaacacctacaatgctgcc
atcgtttataccattgaaaaccaggagcctaccttgcctcatgacaacatgttcaccatc
aaccgggacacaggagtcattagtgtggtcaccagtgggctggatcgagagagtgttccc
aagtataccctggtggttaaagctactgaccttcaaggtttgggcctgagtacatcagca
acagctatgattacagtcagggacaacaacgacaaccctcccatcttcaacccgacaatg
tacgaaggtacggttcctgagaataaggccaatgctgatatcaccaggctcaaagtgact
gatgctgatgtccctgacaccccagcgtggaaggccaagtacaacatattaaatgataat
gagaagcaatttgttgtcatcacagatccagtaacgaatgaaggcattctgagaacagct
aagggcttagattttgaggccaagcagcagtacattctatatgtgacagctgagaatgag
gtcccctttgtggtcagtctttccacctccacagccacagtgactgtggatgtgatagat
gtgaatgaagcccccatcttcatgcctcctatcaagagagtggaagtgcccgaagacttt
ggtgtgggccaggagatcacgtcctacactgcccaggatccagacaagtttatgcaacag
aagataacgtatcgaatttggagggatactgccaactggctggagattaatccggacact
ggggccatttccactcgggctgagttggacagagaggacttggagcatgtgaagaacagc
acatacacggccctcattattgctactgacgatggctctctacctgctactggtactgga
acctttattctgatcctctctgatgtgaatgacaatgcccccataccagaccctcgaagt
atggacttctgccaggtggacccacagcctcataccatatacatcattgatccagacctt
ccccccaatacttctcccttcacagcggaactaatgtatggggcaagtgtcaactggtcc
atcgagtacaaagatgcagcccgagagtctcttcttttgatgccaaaggttcgtttagag
ctgggtgactacaaagtacatctcaagctcacggataaccagaataaagaccaggtgacc
accttagatgtctttatgtgtgactgcgaaggggccgtcaacacctgtaagagacatatg
ccaattgctaacgcaggattgccagtttctgctgttttggggattctcggaggaatcctt
gctttgctaatcctgattctgctgctcctgctatttcttcggaggagaagagtggtcaaa
gagcccttactggcccctgaggatgacactcgggacaacgtttattactatgatgaagaa
ggaggtggagaagaggaccaggactttgacttgagccagttgcacaggggcctggatgct
cgacctgaagtgattcgcaatgatgtggcacctaccctcatgagtgtgccccagtatcgt
ccccgccccgccaatcctgatgaaattggaaattttattgatgaaaacctgaaggcggct
gatagcgaccccactgctcccccttatgactctctgcttgtgtttgactatgaaggaagc
ggttctgaagctgctagtctgagctctctgaactcctcagagtcagaccaagaccaggac
tatgactacttgaacgaatggggcaatcgcttcaagaagctggcagatatgtatggaggc
ggtgaggacgactag

DBGET integrated database retrieval system