KEGG   Loxodonta africana (African savanna elephant): 100659459Help
Entry
100659459         CDS       T04351                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100659459 (GAA)
   00500 Starch and sucrose metabolism
    100659459 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100659459 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659459 (GAA)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100659459 (GAA)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100659459 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100659459
NCBI-ProteinID: XP_023412486
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MEKSAGLCSPRCFITHSQLTMGTDRLPCSWQLARPLLGACAFTLLATAALMGHVLLRDFT
MVPRELAGLSQGLEEAYQARSQGPQHSREHSDRPGPVPAQCDVPPNSRFDCAPEAAITQE
QCEARGCCYIPVRQGPQGPPVGQPWCFFPPSYPSYRLENLTTTQMGYTATLTRATPTFFP
KDILTLQLEVLMETESRLHFMIKDPANRRYEVPLETPRVLRRALTPLYSLEFSQEPFGMV
VRRKLDGCVLLNTTVAPLFFTDQFLQLSTTLPTPYVVGLAEHLSPLMLNTNWTRITLWNR
DMAPEPGTNLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRTTGGILDMYV
FLGPEPKSVVQQYLAVIGHPSMPPYWALGFHLCRWGYSSTAIVRQVVENMTRANFPLDVQ
WNDLDYMDARRDFTFNKHGFEDFPAMVQELHQGGRHYVMIVDPAISSSGPAGSYRPYDEG
LRRGVFITNDTGQPLIGKVWPGASAFPDFTNPETQSWWQDMVAEFHAQVPFDGMWIDMNE
PSNFVKGSEAGCPDNELENPPYVPGERPMAPCGGGSLLGWYVRIRPHVAMLPCPLSCGPC
RCPACSPGLQLTQTALGSRGLGPSSGQRGHWMGLSALCPPAPPRALVMARGTRPFVISRS
TFASHGRYAGHWTGDVWSSWEQLALSVPATLLFNLLGVPLVGADICGFLGNTSEELCVRW
TQLGAFYPFMRNHNDLSSLPQEPYSFSETAQEAMRKAFALRYVLLPHLYTLFHRAHVRGE
TVARPLFLEFPQDPHTWTVDRQLLWGEALLITPVLEAGKTKVTGYFPAGTWYNLQTVPVE
ALGSLPPPPSTPLTSVIRSQGQWVKLPAPLDTINLHLRAGYIIPLQGPGLTTTESRKQPM
ALVVALSPSGEAQGELFWDDGESLGVLERGSYTLVVFLAKNNTVVNKLVHVASEGASLQL
RKVTILGVATAPRQVLSNGVPVSNFTYSPDTKILDVPVSLSVGEEFLISWT
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtcagcaggcctctgcagcccacgctgcttcatcacccacagccagctgacc
atgggcacggaccggctgccctgctcctggcagctggccaggcccctgctaggggcctgt
gccttcaccctcttggccacagctgccctcatggggcatgtcctgctgcgtgatttcacc
atggttccccgagagctggccgggctctcccaaggactggaggaggcttaccaagctcgc
agccaagggccccagcactcccgggagcacagcgacaggccagggccagtgcctgcacag
tgtgacgtgccccccaacagccgcttcgactgtgcccccgaggcagccatcacccaggag
cagtgtgaggcccgcggctgctgctacatcccagtgcggcaaggcccccagggcccccca
gtggggcagccctggtgcttcttcccccccagctatcccagctataggctggagaacctc
accaccacacagatgggctacacggccaccctgacccgcgccacccccaccttcttcccc
aaggacatcctgaccttgcagctggaggtgctgatggaaactgagagccgcctccacttc
atgattaaagatcccgctaacaggcgctatgaggtcccactggagaccccgcgtgtgctc
cgccgggccctgaccccactctacagcttggagttctcgcaggagcccttcggcatggtc
gtgcgcaggaagctggacggctgcgtgctgctgaacacgacggtggcccccctgttcttc
actgaccagtttctgcagctgtccaccaccttgcccaccccatatgtggtgggcctcgct
gagcacctcagccccctaatgctcaacaccaactggaccaggatcaccctctggaatcgg
gacatggcccccgagcctggcacgaacctctacggctcccaccccttctacctggccctg
gaggacggaggctcggcgcatggggtgttcctgctgaacagcaatgccatggatgtggtc
ctgcagccgagcccggccctcagctggaggacgaccggtggcatcctggacatgtatgtc
ttcctggggccagagcccaagagtgtggtgcagcagtacctggcggtcatcgggcaccca
tcgatgccgccctactgggctctgggtttccacctctgccgctggggctactcctccacg
gccatcgtccgccaggtggtggagaacatgaccagggccaacttccccctggacgtccag
tggaatgacctggactacatggatgccagaagggacttcaccttcaacaagcacggcttt
gaggacttccccgccatggtgcaggagctccaccagggtggccggcactacgtcatgatt
gtcgatcctgccatcagcagctcgggccctgccgggagctacagaccctacgatgagggc
ctgaggaggggagtcttcatcactaacgacactgggcagccgctgatcgggaaggtgtgg
cccggagcctccgccttccctgacttcaccaaccctgagacccagagctggtggcaggac
atggtagctgagttccatgcccaggtgcctttcgacggcatgtggatcgacatgaatgag
ccgtccaactttgtaaagggctctgaggccggctgccctgacaatgagctggagaacccg
ccctacgtgccaggtgagcgccctatggccccgtgtgggggtgggtccctgctgggctgg
tacgtcaggatcaggcctcatgtggctatgttgccatgcccactgagctgcggaccttgc
cggtgccccgcgtgctcccctggcctccagctcacccagacagcactgggttctcgaggc
cttggaccgtcaagcgggcagcggggtcactggatgggcctctcagctctctgtccccct
gctccacccagggccctggtgatggctcgggggacacgcccctttgtgatctcccgttca
acctttgccagccacggccgatatgctggccactggacaggggacgtgtggagcagctgg
gagcagcttgccctgtcggtgcctgcaaccctgctcttcaacctgttgggcgtgcccctg
gttggggctgacatctgcggcttcctgggcaacacttcggaggagctgtgcgtgcgctgg
acccagctgggagccttctacccgtttatgcgcaaccacaacgacctcagcagcctgcct
caggagccatacagtttcagcgagacagcacaggaagccatgaggaaggccttcgccctg
cgctacgtgctgcttcctcacctgtacacgctgttccacagggcccacgtcaggggcgag
acggtggcccggcccctcttcctggagttcccccaggatccccacacctggaccgtggac
cgccagctcctgtggggggaggccctccttatcaccccggtgctggaggctgggaagacc
aaggtgaccggctatttccccgcaggcacgtggtacaacttgcagacggtgccagtggag
gccctgggcagcctcccaccgccaccttccacacctctcacatcagttatccgcagccag
ggacagtgggtgaagctacctgccccactggacaccatcaacctccacctgcgggccggg
tacatcatccccttgcagggccccggtctcaccaccactgagtcccgcaagcagcccatg
gccctggtggtggccctgagccctagcggcgaggcccagggggagctcttctgggacgac
ggggagagcctgggagtgctggagcgtgggtcctacaccctggtcgtcttcctggccaag
aataacactgttgtgaacaagctggtgcacgtggccagtgagggagccagcttacagctg
aggaaggtgaccatcctgggtgtggccacagccccacggcaggtcctctccaacggcgtt
ccagtctccaacttcacctacagccctgacaccaagatcctggacgtccccgtgtcacta
tcagtgggagaagagttcctcatcagttggacctga

DBGET integrated database retrieval system