KEGG   Loxodonta africana (African savanna elephant): 100659469
Entry
100659469         CDS       T04351                                 

Gene name
OAS2
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100659469 (OAS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100659469 (OAS2)
   05171 Coronavirus disease - COVID-19
    100659469 (OAS2)
   05164 Influenza A
    100659469 (OAS2)
   05162 Measles
    100659469 (OAS2)
   05168 Herpes simplex virus 1 infection
    100659469 (OAS2)
   05169 Epstein-Barr virus infection
    100659469 (OAS2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     100659469 (OAS2)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 100659469
NCBI-ProteinID: XP_003419338
LinkDB
Position
Unknown
AA seq 700 aa
MGSWWSQQNSIPAENLEMYIQLFLQPQGDCQKLIDHAVNTICAVLQDAKDFPLVKDVAKG
GSYGRETVLRGTSDGTLVIYLSEFKQFLDQKTSEREIILKEIWKRLEASQHLKEMAAKLE
VQQSQGQLILWLSTKGQSIIFEVLPAFNALGFSKKPSPEIYRELKRVSDATAASPGEFST
CFMKLQQKFFNDRPRKLKDLILLVKYWYQQCRKELEKSTQLPVYALELLTVYAWEQGCGQ
HNFDIAEGIRTVLGLIKQYKHLCVYWTAYYNFEDETIRNILQSQLRASRPVILDPTDPMN
NVSRDKNECWELLNLKAREWLSSLSLNDSSPGPSWNILPAPLYATPGHLLDKFIHDFLQP
SKNFLDQTNKAVDIICRFLREKCFQHSEDQKIKIQKIVRGGSTAKGTALKSGSDADLILF
PNLLKSFPSQKHNRSEIIKEIHKQLEACQQEEKFKVKVEIAKWKSPRALSFSLKSKEFNA
ELEESVEFDVLPAFNVLGQWGSVSPPSPSIYAELIQQYESGDYIEGEFSSCFTELQRDFI
ISRPTKLKSLIRLVKYWYKQCERKLKTKGSLPPKYALELLTVYAWEQGSRALDFSTAEGF
RTVLELVTKYQQLCIFWKVNYNFEDVIVGKFLLAQIQKTRPVILDPAEPTGDVGGGDRWC
WHLLAQEAKAWLLSSLCFKDGVGNPVKSWNVPTAQTLERC
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgggaagctggtggtcacaacagaactccattcctgctgagaacctggaaatgtatatc
cagctctttctacagccccagggagactgtcagaagctgatcgaccatgccgtgaacacc
atctgcgcagtcttgcaggatgccaaagacttccccctggtaaaggatgtggccaaaggt
ggctcctatggccgggaaactgtcctcagaggcacatccgatggtactctcgtcatctac
ctcagtgaattcaaacaatttttggatcagaagacaagcgaacgtgaaataatcctcaaa
gaaatctggaagcgcctagaagcctcacagcacttaaaggaaatggcagccaagttggag
gtccagcagtcccaaggccagctcatactctggctgtccacaaaggggcaaagcatcatc
tttgaggtactgcctgccttcaacgccctgggctttagtaagaagcccagccccgagatc
tatcgagaactcaaaagagtctcagatgcgacagcagcttctcccggtgagttctcaacc
tgcttcatgaagctccagcagaagttttttaacgaccgtcccagaaaactgaaggatttg
atcctcttggtaaagtactggtatcaacagtgccgaaaagagctggagaagtcaacccag
ctgcctgtatatgctctggagctgcttacggtttatgcctgggaacaggggtgtggacaa
cacaactttgatatagctgaaggcatcagaactgttctggggctgatcaagcagtataag
catttgtgtgtctactggacagcctactacaactttgaggacgagaccatcaggaacatc
ctgcagtcccagctccgggcgtcgaggccagtcatcttggatccaactgacccaatgaat
aatgtgagccgagataaaaatgagtgctgggaactgctaaacctaaaagctcgagaatgg
ttgtcttctctcagcctgaatgacagctcacctggaccatcctggaatattctgccagca
ccactctatgcaactccaggccatcttctagataaattcatccacgactttctccagccc
agcaaaaatttccttgatcagaccaacaaagctgttgacatcatctgtagattccttaga
gaaaagtgctttcaacattcagaagaccagaagatcaagattcagaagattgtcaggggg
gggtcaaccgccaaaggcacagcactgaagagtggctctgacgccgacctcatccttttc
cctaacttgcttaaaagctttccctcccaaaaacacaaccgaagtgaaatcatcaaggaa
atccataagcagctggaagcctgtcagcaggaggagaagtttaaagtgaaggttgagatt
gccaaatggaagtctcccagggcgctcagcttctctctgaaatccaaagagttcaatgca
gagctggaggaaagtgtcgagtttgatgtgctacccgccttcaatgtactgggtcaatgg
ggctctgtctctccccccagccccagcatctatgctgagctcatccaacagtacgagtct
ggggactacattgagggagagttttcctcctgtttcacggagctgcagcgggatttcatc
atctcccgtcccaccaagctgaagagcttaattcgcctggtgaagtactggtacaaacag
tgtgaaaggaaactgaagacgaaggggtctctgcccccaaagtacgccttggagctgctg
accgtttatgcctgggagcaggggagcagggcgctggatttttctaccgctgaagggttc
cggacagtcctggagctggtcacaaagtatcagcagctctgcattttctggaaagtcaac
tacaactttgaggacgtgattgtgggaaagttcctactggcccagatccagaaaaccagg
cctgtgatcttggacccagctgaacctacaggcgacgtgggtggaggagatcgctggtgt
tggcatctcctagcccaagaagctaaggcgtggttgttgtcatctctctgcttcaaagat
ggagttggaaatccagttaaatcatggaatgttccaacagcgcagacactggaaagatgt
tga

KEGG   Loxodonta africana (African savanna elephant): 104846792
Entry
104846792         CDS       T04351                                 

Gene name
OAS3
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104846792 (OAS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    104846792 (OAS3)
   05171 Coronavirus disease - COVID-19
    104846792 (OAS3)
   05164 Influenza A
    104846792 (OAS3)
   05162 Measles
    104846792 (OAS3)
   05168 Herpes simplex virus 1 infection
    104846792 (OAS3)
   05169 Epstein-Barr virus infection
    104846792 (OAS3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     104846792 (OAS3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Other DBs
NCBI-GeneID: 104846792
NCBI-ProteinID: XP_010597263
LinkDB
Position
Unknown
AA seq 1089 aa
MDVYSTPAAALDRLVARSLQPPAEFVGAARRALGALGATLRERGGRPGATGLEPRVLKII
KGGSSGRGTALRGGCDSELVVFLNCFKTYEDQAPRRAEILSEMRAQLESWRMDPIPGLSL
EFPEQDTSGLLQFRLVFEDLENWMDVRLVPAFDALGQLSPGMKPKPQVYSALLNSGCRGG
EHAACFAELQRDFVNIRPAKLKNLILLVKHWYRQVCPQEAGRGMLPPVYALELLTIFAWE
QGCQKDAFSLSQGLRTVLGLIHQYQHLCIFWTVNYGFEDPAVGQFLRGQLKRPRPVILDP
ADPTWDVGNGAAWRWDVLAQKAGSCYDHPCFLQAPGRPVQPWEGLGLPRAGCSDLGHPIQ
RDPDQSIPEDSRSNSAVCPRAGSKKRSYPAPSPLGTSSSTPSIPGTVLDLSQIPTKELDR
FIQDHLKPSPQFQEQVNRAIDSILRCLRENCVHKASRVSKGGSFGRGTALRGGCDVQLVI
FLNCFKNYQDQRAYQAEILDDMWALLESWSQDPVPNLSLKFPEQKARGTLQFRLISTALE
SWIDVSLLPAFDAVGQHSSGTKPKPQVYSTLLNSSCQEGEHAPCFTELRSNFVNTRPAKL
KNLILLVKHWYHQVAAQDRGGRPACASLPSAYAMELLTIFAWEQGCRKDSFSMAQGLRTV
LGLVQQHQHLCVYWTVNYDLEDPALRTHLLGQLQKPRPLVLDPADPTWNVGQGSWELLAQ
EAAALEKQAGFVNGDGTSVLPWDVMPALLDQTPARDLDKFISEFLQPTRQFLEQVNKAVD
TICSFLRENCFRNSPIKVLKVVKGGSSAKGTGLRGRSDADLVVFLSCFTQFTDQGNNRAE
IISEIRAQLEACQREQQFKVKFEISKWENPRVLSFSLTSLTTLDQSVDFDVLPAFDALGQ
LGSGGRPSPQVYVDLIHSYNNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYRQCNK
MPKGRGSLPPQHGLELLTVYAWEQGSQEPQFNMAEGFRTVLELVSQYRQLCIYWTVNYDA
EDKTIGDFLKRQLQKPRPIILDPADPTGNLGHNARWDLLASEAATCVSALCCMGKDGTPV
QPWPVKAAV
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggacgtgtacagcaccccggccgccgcgctggacaggttggtggctcgcagcctacag
ccaccagcggagttcgtgggggcggcgcggcgcgccctgggcgccctgggcgccacccta
cgagagcgcggggggcgccccggagccaccggcctggagccgcgggtgctgaaaattatc
aagggaggctcctctggccggggcacggctctgaggggcggctgtgattctgaacttgtc
gtcttcctgaactgcttcaagacttatgaggaccaggccccccgccgtgcagaaatcctc
agtgagatgagggcacagctggaatcctggcggatggaccctatccctggcctgagcctg
gagtttcctgagcaggacacgtctgggttgctgcagttccgactggtgtttgaggacctt
gaaaactggatggacgtccgcctggtgcccgcttttgatgccctgggtcagctgagccct
ggtatgaaacccaagccccaggtctattctgccctcctcaacagtggctgccgggggggc
gagcatgccgcctgcttcgcagagctgcagagggacttcgtgaacattcgcccagccaaa
ctgaagaacctgatcctgctggtgaagcactggtaccgccaggtgtgcccacaagaggcg
gggagggggatgctgcccccagtttacgccctggagctgctgaccatcttcgcctgggag
cagggctgccagaaggacgccttcagcctgtcccaaggcctccgaaccgtcctgggcctg
atccaccagtaccagcacctgtgtattttctggaccgtcaactatggctttgaggaccct
gcagttgggcagttcttacggggccagctgaaaagacccagacccgtgatccttgacccg
gcagacccaacgtgggacgtagggaatggggcagcctggcgctgggacgtgctggcccaa
aaggcagggtcctgctatgaccacccgtgctttcttcaggcacctgggaggcctgtgcag
ccctgggaagggctgggccttccacgtgctgggtgctcagatttgggccaccccatccag
agagaccctgaccagagcatccccgaggacagcaggagcaacagtgccgtgtgccccaga
gcaggaagcaagaaacgctcgtacccagctcccagccccttggggacgagcagcagcacc
ccctctataccagggacagtcttggatctgtctcagatccccaccaaggagctggaccgc
ttcatccaggaccacctgaagccgagccctcaattccaggagcaggtgaacagggccatc
gacagcatcttgcgctgcctccgtgagaactgtgtccacaaggcctcgagagtcagcaag
gggggctcttttggccggggtacagccctaaggggtggctgtgatgtacaacttgtcatc
ttcctcaactgcttcaagaactaccaggaccagagggcctaccaggcagaaatccttgat
gacatgtgggccctgctggaatcctggtcccaggacccagtccccaacttgagcctcaag
tttcctgaacagaaggcgcgtgggactctacagttcagactgatttccacggccttggaa
agctggatagacgttagcctgctacctgccttcgatgccgtagggcagcacagctctggc
accaaacccaagccccaggtctactccaccctcctcaacagcagctgccaggagggcgag
cacgcaccctgctttacagagctacgcagcaactttgtgaacactcgcccagccaagctg
aagaacttgatcctactggtgaagcactggtaccaccaggttgcagcccaggacagaggt
ggacggccagcctgtgcttctctgccttcagcctatgcaatggagctcctgaccatcttt
gcctgggagcagggctgcaggaaggacagtttcagcatggcccaaggcctccgaactgtc
ctggggctcgtccagcagcatcagcacctctgtgtctactggactgtcaactacgacctt
gaagacccagctctcagaacgcacctgcttggccagctccagaaacccagacccctggtg
ctagaccccgctgaccccacctggaatgtgggccagggcagctgggagctgttggcccag
gaagcggcagccctggagaaacaagccggttttgtgaatggagacgggacgtctgtgctg
ccctgggacgtgatgcccgctctccttgaccagaccccagccagggacctagacaagttc
atcagtgagttcctccagcccacccggcagttcctggagcaggtgaacaaggcggtcgat
accatctgctccttcctgagggagaactgtttccggaattctcccatcaaagtgctcaag
gtggtcaagggtggctcttcagccaaaggcacaggtctgcgaggccgctcggacgccgac
ctggtggtctttctcagctgcttcacacagttcactgaccaggggaacaaccgggccgag
atcatctcagagatccgagcccagctggaggcgtgccagcgggaacagcagtttaaggtg
aagttcgaaatctccaaatgggagaacccccgtgtgctgagcttctccctgacgtccctc
acgacactggaccagagcgtggactttgacgtgctgccagcctttgatgccctaggccag
ctgggctctggcggccggcccagccctcaagtctacgtggacctcatccacagctacaac
aatgcaggcgagtactccacctgcttcacagagctgcagcgggacttcatcatctcccgc
cccaccaagctgaagagtctaatccgactggtgaagcactggtaccggcagtgtaacaag
atgcctaagggcagaggctccctgcccccccagcacgggctggaactcctgacagtgtac
gcctgggagcagggcagtcaggagcctcagttcaacatggctgagggcttccgcaccgtc
ctggagctggtcagccagtaccgccagctctgcatctactggactgtcaactacgatgct
gaggacaagaccattggagacttcctgaaacggcagctgcagaagcccaggcccatcatc
ctggatccagctgacccaacgggcaacctgggccacaatgcccgctgggacctgttggcc
agtgaagctgcaacttgtgtgtctgccctgtgctgcatgggcaaggacggcacccccgtc
cagccctggccagtgaaggctgctgtgtga

KEGG   Loxodonta africana (African savanna elephant): 104846793
Entry
104846793         CDS       T04351                                 

Gene name
OAS1
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 1 isoform X1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104846793 (OAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    104846793 (OAS1)
   05171 Coronavirus disease - COVID-19
    104846793 (OAS1)
   05164 Influenza A
    104846793 (OAS1)
   05162 Measles
    104846793 (OAS1)
   05168 Herpes simplex virus 1 infection
    104846793 (OAS1)
   05169 Epstein-Barr virus infection
    104846793 (OAS1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     104846793 (OAS1)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 104846793
NCBI-ProteinID: XP_010597265
LinkDB
Position
Unknown
AA seq 379 aa
MEELRNTPPRNLDKFIEDHLLPDTLFRTQVREAVDTICSFLKERCFIGSVRVSKVVKGGS
SGKGTALKGRSDADLVVFLSNLTSFQEQLKHRGIFIEEIRKQLEACQREEEFDVEFEVQS
KWENPRVLSFMLSSHCQNKCVNFDVLPAFDALGQVTKDYKPDPQIYVQLIRECSRGGEFS
TCFTELQRAFLKQRPTKLKSLIRLVKYWYQECKKNLGKPLPAQYALELLTVYAWEHGSNK
TDFNTAQGFRTVLELVRDYRLLCIYWTKYYDFENPVIEQYLIKQLQKPRPVILDPADPTG
NLGDGHPDSWRRLAGEALVWLSYPCFKNQDKSLVGPWNVPPEKDYMGGAFRSYVQSRRHI
THETVSTPQAEEEWTCTIL
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggaggaactcagaaataccccgcccaggaatctggacaagttcatcgaagaccatctc
ctgccagacacactgttccgcacgcaggtcagagaagccgttgacaccatctgtagcttc
ctgaaggaaaggtgcttcatcggatctgtgcgggtgtccaaggttgtgaagggtggctcc
tccggcaaaggcaccgctctcaaaggccgatctgacgctgacctcgtggtcttcctcagc
aatctcacaagttttcaggagcagctaaagcaccggggaatattcattgaggaaatcaga
aaacagttggaagcctgccaaagggaagaagagtttgacgtggaatttgaggtccagagt
aaatgggaaaacccccgcgtgcttagcttcatgctaagttcccactgccaaaacaagtgt
gtgaactttgatgtgctgcctgcctttgacgccctgggtcaggtgactaaagactacaaa
cctgacccccaaatctacgtccagctcatccgtgagtgctcccgggggggcgagttctcc
acctgcttcacagagcttcagcgagccttcctgaagcagcgtcccaccaagctgaagagc
ctcatccgcctggtcaagtactggtaccaagagtgtaagaagaacctggggaagccactg
ccagcacaatacgcccttgagctcctgactgtctacgcttgggagcatgggagcaacaaa
acagacttcaacacagcacaggggttccggaccgtcttggaattagtccgggactacaga
ctgctttgcatctactggacaaagtattacgactttgaaaaccccgttattgaacaatat
ctgatcaagcagctgcagaaacccaggcctgtgattctagacccggcggaccctacagga
aatttgggtgacggacacccagacagttggcggaggctggccggggaggctttagtctgg
ctgagctacccctgctttaagaatcaggataagtctctcgtgggcccctggaatgtgccg
cctgaaaaagactacatgggtggggccttccggagttatgtgcagagccgtagacacatc
acgcacgagacagtgtccactccacaggcagaagaggaatggacgtgcaccatcctgtga

DBGET integrated database retrieval system