KEGG   Loxodonta africana (African savanna elephant): 100659509
Entry
100659509         CDS       T04351                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04310  Wnt signaling pathway
lav04350  TGF-beta signaling pathway
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04659  Th17 cell differentiation
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100659509 (SMAD4)
   04350 TGF-beta signaling pathway
    100659509 (SMAD4)
   04390 Hippo signaling pathway
    100659509 (SMAD4)
   04371 Apelin signaling pathway
    100659509 (SMAD4)
   04068 FoxO signaling pathway
    100659509 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100659509 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100659509 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100659509 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100659509 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659509 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659509 (SMAD4)
   05212 Pancreatic cancer
    100659509 (SMAD4)
   05225 Hepatocellular carcinoma
    100659509 (SMAD4)
   05226 Gastric cancer
    100659509 (SMAD4)
   05220 Chronic myeloid leukemia
    100659509 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100659509 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100659509 (SMAD4)
   05161 Hepatitis B
    100659509 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100659509
NCBI-ProteinID: XP_003406342
UniProt: G3T9P9
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLPTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacactggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgctcgtctctggcgg
tggcctgatcttcacaaaaacgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccttatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggac
gaatatgttcatgactttgagggacagccatcgttacccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcaacagagacatacagcactccagctctg
ttagccccatctgagtctaatgccaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatcctggcaggcagccacagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaaccgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccggttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gaatattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcagtctttgtacagagttactacttagacagagaagccggacgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgccagatgcagcagcaggcggccacggcacaagctgcagccgccgct
caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca
gccatcagtttgtctgctgctgctggaattggtgtggatgaccttcgtcgcttgtgcata
ctcaggatgagtttcgtgaaaggctggggaccggattacccaaggcagagcatcaaggaa
acaccttgctggattgagatccacctacaccgggccctgcagcttctagatgaagtcctt
cacaccatgcctattgcagacccacagcctttagactga

DBGET integrated database retrieval system