KEGG   Loxodonta africana (African savanna elephant): 100659551
Entry
100659551         CDS       T04351                                 

Gene name
CRHR1
Definition
(RefSeq) corticotropin-releasing factor receptor 1 isoform X3
  KO
K04578  corticotropin releasing hormone receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04730  Long-term depression
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659551 (CRHR1)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    100659551 (CRHR1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659551 (CRHR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100659551 (CRHR1)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    100659551 (CRHR1)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 100659551
NCBI-ProteinID: XP_010592837
UniProt: G3UEN0
LinkDB
Position
Unknown
AA seq 415 aa
MGQRPQLRLVKALLLLGLNPVSASLQAQHCESLSLAGNISGLQCNASVDLIGTCWPRSPV
GQLVARPCPAYFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTSRLHKWMFICIGWGVPF
PIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggacagcgaccgcagctccggcttgtcaaggccctcctccttctgggactgaaccct
gtctctgcctccctccaggcccagcactgcgagagcctgtccctggccggcaacatctct
ggactgcagtgcaatgcgtccgtggacctcattggtacctgctggccccggagccccgtg
gggcagctggtggctcggccctgccctgcctatttctacggtgtccgctacaataccaca
aacaacggctaccgggagtgcctggccaatggcagctgggccgcccgcgtgaactactcc
gagtgtcaggagattctcaatgaggagaagaagagcaaggtgcactaccacatcgctgtc
atcatcaactacctgggccactgcatctccctggtggcccttctggtggcctttgtcctc
tttctgcggctcaggagcatccggtgcctgagaaacatcatccactggaacctcatctcg
gccttcatcctacgcaacgccacgtggttcgtggtccagctcaccatgagccctgaggtc
catcagagcaacgtggcatggtgcaggttggtgacagctgcctacaactacttccatgtg
accaacttcttctggatgttcggcgagggctgctacctgcacacggccatcgtactcacc
tactccaccagccggctacataagtggatgttcatctgcattggctggggggtgcctttc
cccatcatcgtggcctgggccattgggaagctgtactacgacaatgagaagtgctggttt
ggcaaaaggcctggggtgtacaccgactacatctaccagggccccatgatcttggtcctg
ctgatcaattttatcttccttttcaatatcgtccgcatcctcatgaccaaactccgggca
tccaccacgtcagagaccattcagtacaggaaggcggtgaaagccactctggtgctgctc
cccctcctgggcatcacgtacatgctgttctttgtgaaccctggggaggacgaggtctcc
cgggttgtcttcatctacttcaactccttcctagagtccttccagggcttcttcgtgtct
gtgttctactgtttcctcaacagtgaggtccgctcagccatccggaaaagatggcaccga
tggcaagacaagcactcgatccgtgcacgggtggctcgtgccatgtccatccccacctcc
cccacccgggtcagcttccacagcatcaagcagagtaccgccctctga

KEGG   Loxodonta africana (African savanna elephant): 100672505
Entry
100672505         CDS       T04351                                 

Gene name
CRHR2
Definition
(RefSeq) corticotropin-releasing factor receptor 2
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100672505 (CRHR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100672505 (CRHR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100672505 (CRHR2)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    100672505 (CRHR2)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 100672505
NCBI-ProteinID: XP_003406971
LinkDB
Position
Unknown
AA seq 378 aa
MEAALLQSLLEANCSLALAEELLLDGWGLPLDPEDPYSYCNTTLDRIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASRINYSQCEPILDDKKKYDLHYRIALVVNY
LGHCISLATLVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVLWFLLQLIDHEVHESNE
VWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKWLFLFIGWCIPCPIIIV
WAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSE
TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCF
FNGEVQGRGGWVLASLRP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggaagcggcactgcttcagagcctgctggaggcgaactgcagcttggcactggccgaa
gagctgctcttggacggctgggggctgcccctggaccccgaggatccctactcctactgc
aacacaaccttggatcggattgggacgtgctggccccggagcgcggccggagccctggtg
gagaggccgtgccccgagtacttcaacggcgtcaagtacaacacgacccgaaatgcctat
cgagagtgcttagagaatgggacatgggcttctcggatcaactactcacagtgtgagccc
attttggatgataagaagaagtatgacctgcactaccgcatcgccctcgttgttaactac
ctgggccactgcatttcgctggccacccttgtggccgccttcctgctcttcctagccctg
cggagcatccgctgcctgcggaacgtgattcactggaacctcatcaccacgttcatcctg
agaaatgtcttgtggttcctgctacagctcatcgaccacgaagtgcatgagagcaacgag
gtctggtgtcgctgcatcaccaccatcttcaactacttcgtggtgaccaacttcttctgg
atgttcgtggagggctgctacctgcatacagccatcgtcatgacctactccactgagcgc
ctgcgcaagtggctcttcctcttcatcggatggtgcatcccctgccccatcatcattgtc
tgggccattggaaaactctactatgaaaatgaacagtgctggtttggcaaggagcccggt
gatctggtggactacatctaccaaggccccatcatccttgtgctcctgatcaattttgta
tttctgttcaacatcgtcaggattttaatgacaaaattacgagcctccaccacatccgag
acgatccagtacaggaaggcggtgaaggccaccctggttctcttgccccttctgggcatc
acctacatgctcttcttcgtcaatcctggggaggatgacctctcgcagattgtgttcatc
tatttcaactccttcctgcagtccttccagggtttctttgtgtctgtcttctactgcttc
ttcaatggagaggtacaaggccggggaggctgggtgctcgcaagcctcagaccctag

DBGET integrated database retrieval system