KEGG   Loxodonta africana (African savanna elephant): 100659585
Entry
100659585         CDS       T04351                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X2
  KO
K16341  Bcl-2-like protein 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04068  FoxO signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04932  Non-alcoholic fatty liver disease
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100659585 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    100659585 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100659585 (BCL2L11)
   04215 Apoptosis - multiple species
    100659585 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659585 (BCL2L11)
   05206 MicroRNAs in cancer
    100659585 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659585 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100659585 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100659585 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100659585 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact
Other DBs
NCBI-GeneID: 100659585
NCBI-ProteinID: XP_010599640
LinkDB
Position
Unknown
AA seq 199 aa
MAKQPSDVSSECDREGGQLQPAERPPQPPQLRPGAPTSLLTEPQGNPDGEGDSCPQGSPQ
GPQAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
QAINHYLSAMASMRQSQALPADLRPEIWIARELRRIGDEFNAYYPRRAFLNNYQAAEDHP
QMVILRLLRYIVRLVWRMQ
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttcagatgtaagttctgagtgtgacagagaaggtggacagttacag
cctgcggagaggcccccgcagcctcctcagctcaggcctggggcccctacctctctgctc
acggagcctcaaggtaatcctgacggtgaaggggacagctgcccccagggcagcccacag
ggcccgcaggccccaccagccagccccggcccttttgctaccagatccccgcttttcatc
tttgtgagaagatcctccctgctgtctcgatcctccagcgggtatttctcttttgacaca
gacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctccttgc
caggccatcaaccattacctcagtgcaatggcttccatgaggcagtctcaggctctacct
gcagacctgcgcccggagatctggattgcgcgagagctacggcgcattggagacgaattc
aatgcctactacccaaggagggcttttttgaataattaccaagcagccgaagaccaccct
caaatggttatcttacgtctcttacgctacatcgtccgcctggtgtggagaatgcagtga

DBGET integrated database retrieval system