KEGG   Loxodonta africana (African savanna elephant): 100659604
Entry
100659604         CDS       T04351                                 

Gene name
DLGAP1
Definition
(RefSeq) LOW QUALITY PROTEIN: disks large-associated protein 1
  KO
K15008  discs, large-associated protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100659604 (DLGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100659604 (DLGAP1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100659604 (DLGAP1)
SSDB
Motif
Pfam: GKAP
Other DBs
NCBI-GeneID: 100659604
NCBI-ProteinID: XP_023399729
LinkDB
Position
Unknown
AA seq 977 aa
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVDHHPADHPYYTQRNSFQAECVGP
FSDPLASSTFPRRHYTSQQELKDECALVPRNLATKANRIPPNLLDQFERQLPLNRDGYHT
LQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDNTQTMRYSK
RSKSKERRAEPKARSNASPAWWSSDDNLDGDMCIYHTPSGVMTMGRCPDRSASQYFVEXY
NTISEQXVKASRGNNDVKCXTCANLPVXLDAPLLKKSAWSSTLTVSRAREVYQKASVNVD
QALVKAESCQQERSCQYLQVPQDEWSGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL
DSLDPAGLLTSPKFRSRNESRFHSTRFLSQVSEMEVNGQFESVCESVFSELESQAVEALD
LPMPGCFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKK
TPPPVPPRTTTKPFISITAQSSTESAQDAYMDGQGQRGDMISQSGLSNSTESLDSMKALT
AAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAE
EPDKTGENKVPSKFQSIGVQVEEEKCFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDN
SCPNPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDP
LEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERDNNLPEDILGKIRTAVGSAQL
LMAQKFYQFRELCEENLNPSAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWK
QMDPLDKKERRVPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSAT
ESAESIEIYIPEAQTRL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaaagggttatccggcagccgcagccatcaccacggtgtcacctgtgattccgcctgt
gactcactctcgcaccactcggaccgcaagccatacctgctgagcccagtggaccaccac
ccggccgaccacccctactacacgcagcgcaactctttccaggccgagtgcgtgggcccc
ttcagcgacccgctggccagcagcaccttcccgcggcgacactacacgtcgcagcaggag
ctaaaggacgagtgtgccctggtgccccgcaacctggccaccaaagccaaccgcattcct
cccaacctcctggatcagtttgaaaggcagctgcccctcaaccgggatggctaccacacg
ctgcagtacaagcgcactgccgtggagcaccgcagcgacagccctggccgcatccggcat
ctggtccactcggtccagaagctcttcaccaagtcgcattctctggaggggccgtccaag
ggcagcgtcaacgggggcaaagccagccccgacaacacgcagaccatgagatacagcaag
cgcagcaagagcaaggagcggcgtgccgagcccaaagcgcgatccaacgcctccccagcg
tggtggagctcggatgacaacctggatggtgacatgtgcatctaccacacgccctcgggc
gtgatgaccatgggcaggtgccctgaccgctctgcttcccagtacttcgtggagncctac
aacaccatcagcgagcagngcgtgaaggcctcccggggcaacaatgatgtcaagtgcntc
acctgtgccaacctgccggtcnacttggatgccccgctcctgaagaagagtgcctggtcc
tccactctgaccgtgagccgagcccgggaggtttaccagaaagcctcagttaacgtggac
caggccctggtgaaggcagagtcctgtcaacaagaacgttcctgccagtaccttcaggtt
cctcaagatgaatggtcagggtacactcctcggggtaaagacgatgaaattccttgccga
agaatgcggagtggcagctacatcaaggccatgggggatgaagacagtggcgactcagac
acaagtcccaagccttctcccaaagttgctgcacgaagagagagctatctcaaggctacc
cagccatcccttacagaactcaccacactcaagatttccaatgaacactcgcccaaactg
cagatccggagccacagttacctgagggctgtcagtgaagtgtccatcaaccggagcctg
gacagcctggaccctgcaggcctgctcacatcacccaagttccgctccaggaatgaatct
aggtttcacagcacgcggtttctctcgcaggtgagtgagatggaggtgaatggccagttc
gagtctgtgtgtgaatccgtcttcagcgaactggagtcacaggcagtggaagccctggac
ctgcccatgcccggctgcttccgcatgcggagccacagctacgtgcgggccatcgagaag
ggctgctcccaggacgacgagtgtgtgtccctgcggtcttcctcccctcctcgaaccacc
accaccgtgaggaccatccagagcagcaccgtgtcatcttgcattacaacatataagaag
acaccacctccagtcccacccagaactaccacgaaacctttcatttctatcacagcccag
agtagcacagagtctgcccaggatgcctacatggacggacagggccagcgaggcgacatg
atcagccagtctggactcagcaactccacggagagcctagacagtatgaaggctctcaca
gctgccatcgaagctgcaaatgcccagatccatggccctgcgagtcagcacatgggcaac
aacacggccaccgtcaccaccaccaccaccatagccaccgtcactacagaggacaggaag
aaggatcactttaagaaaaacagatgcctctctattgggatacaggttgacgatgctgaa
gaacctgacaaaacaggggagaataaagtgcccagtaagttccagtccataggagtgcaa
gtagaagaagagaagtgcttccgcaggttcactcgatccaacagtgtgaccacagcagta
caggccgacctggacttccatgataatctggaaaattccctggaatctatagaggacaat
tcatgtcccaacccaatggccagacagttttcccgggatgccagcacctcaacagttagc
attcagggctcaggaaaccactaccacgcctgtgcagcagacgatgactttgacacagat
ttcgacccctctattctgcctcccccggatccttggattgactctatcactgaagatcct
cttgaggctgttcaaaggtcagtgtgtcaccgagatggccactggtttctaaagcttctt
caggcagagcgagaccgcatggaagggtggtgccagcagatggagagagaagaacgggac
aacaacctgccagaggacattctagggaaaatccgaaccgcagtgggcagtgcccaactt
ctcatggcccagaaattctaccagttcagagaactgtgtgaagaaaacctgaaccccagt
gctcatccaaggcccacctcccaggatttggcggggttttgggacatgctgcagttgtcc
atcgaaaatattagtatgaaatttgatgaacttcatcagttaaaggccaataattggaaa
cagatggatcctcttgacaagaaggagagaagggtccctcctccagtgccaaagaagccg
gcgaagggccccgcgccgctgatccgggagcgctcgctggagagctcgcagcgccaggag
gcccgcaagcgcctgatggctgccaagcgcgccgcgtccgtccgccagaactcggccacc
gagagcgcggagagcatcgagatctacatccctgaggcgcagacccggctctga

DBGET integrated database retrieval system