KEGG   Loxodonta africana (African savanna elephant): 100659617
Entry
100659617         CDS       T04351                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04066  HIF-1 signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04659  Th17 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05211  Renal cell carcinoma
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100659617 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100659617 (HIF1A)
   04137 Mitophagy - animal
    100659617 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100659617 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100659617 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659617 (HIF1A)
   05205 Proteoglycans in cancer
    100659617 (HIF1A)
   05230 Central carbon metabolism in cancer
    100659617 (HIF1A)
   05231 Choline metabolism in cancer
    100659617 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100659617 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100659617 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659617 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100659617 (HIF1A)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100659617 (HIF1A)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 PAS HIF-1 PAS_9 PAS_4 HLH DDRGK
Other DBs
NCBI-GeneID: 100659617
NCBI-ProteinID: XP_010586982
LinkDB
Position
Unknown
AA seq 822 aa
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEVRIDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYDYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTES
DDQQLEEVPLYNDVMLPSSSEKLQNMNLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSDYCFDVDSDMVNEFKLELVEKLF
AEDTEAKNPFATQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPQSTSTITVFQ
QTQMQEPAIIANTSTATTDELKTVTKDGMEDIKILIASPSPTHVPKETTSARTSPYNDTQ
SRTASPSRAGKGVIEQTEKSHPRSPNLLSVTLSQRTTVPEEELHPKIIALQNAQRKRKME
HDGSLSQAVGIGTLLQQPEDRATTSLSWKRVKGCKSSEQNGLEQKTIILIPSDLACRLLG
QSMDESGLPQLTSYDCEVNAPVQGSRNLLQGEELLRALDQVN
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgcgaacgacaagaaaaagattagttctgaacgccgaaaagaa
aagtctcgagatgcagccaggtctcggcgaagtaaagagtctgaagttttttatgagctt
gctcatcagttgcctcttccccataatgtcagctcgcatcttgataaagcttctgttatg
aggcttaccattagctacttgcgtgtgaggaaacttctagatgctggtgatttggatatt
gaagatgaaatgaaggcacagatgaattgcttttatctgaaagctctagatggttttgtt
atggttctcacagatgatggtgacatgatttacatttctgataacgtgaacaaatacatg
ggattaactcagtttgaattaactggacacagtgtgtttgattttactcatccgtgtgac
catgaggaaatgagagaaatgcttacccacagaaatggccctgtgaaaaagggtaaagag
caaaacacacaacgaagcttttttctcagaatgaagtgtaccctaactagccgggggaga
actatgaacataaagtctgcaacatggaaggtacttcattgcacaggccatattcatgta
tacgacaccaacagtaaccaatctcagtgtgggtataagaaaccacctatgacatgtttg
gtgctgatatgtgaacccattcctcacccatcaaatattgaagttcgaatcgatagcaag
acttttctcagtcgtcacagcctggacatgaaattttcttattgtgatgaaagaattact
gaattgatgggatatgagccagaagaacttttgggtcgctcaatttatgactattatcac
gctttggactctgatcatctgaccaaaactcatcacgatatgtttactaaaggacaggtc
accacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaactcaa
gcaactgtcatatacaacactaagaactctcaaccacaatgcattgtatgtgtaaattat
gttgtgagtggtataattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
ctcaaacctgttgagtcttcagatatgaaaatgactcagctattcaccaaagttgaatca
gaagatacaagtagtctctttgataaacttaagaaggaacctgatgctttaactttgctg
gccccagcggctggagacacaatcatatctttagattttggcagcaatgacacagaaagt
gatgatcaacaacttgaggaagttcccttgtataatgatgtaatgcttccctcatccagt
gaaaaattacagaatatgaatttggcaatgtctccattacctgcctctgaaactccaaag
ccacttcgaagtagtgctgaccctgcactaaatcaagaagttgcattaaaattagaacca
aatccagagtcactggaactttcttttactatgccccagattcaagatcagccagccagc
ccttctgatggaagcactagacaaagttcaccagagcctaacagtcccagtgactattgt
tttgatgtggacagtgatatggttaatgaattcaagttggaattggtagagaaacttttt
gctgaagacacagaagcaaagaatccatttgccacacaggacactgatttagacttggag
atgttagccccctacatcccaatggatgatgacttccagttacgttcatttgatcagtta
tcaccattagaaagcagttctgcaagccctcaaagtacgagcacaattacagtattccag
cagactcaaatgcaggaacctgctattatcgccaacacttccactgccaccactgatgaa
ttaaaaacagtgacaaaagacggtatggaagacattaaaatattgattgcatctccatct
cctacccacgtacctaaagaaactactagtgccagaacatcaccatataatgatacacaa
agtcggacagcctcaccaagcagagcaggaaaaggagtcatagaacagacagaaaaatct
catccaagaagccctaacctgttatctgtcactttgagtcaaaggactactgttcctgag
gaagaattacacccaaagataatagctttgcagaacgctcagagaaagcgaaagatggaa
cacgatggctcactttctcaagcagtaggaattggaacattattacaacagccagaggat
cgtgccactacatcactttcttggaaacgtgtaaaaggatgcaaatctagtgaacagaat
ggactggagcaaaagacaattattttaataccctctgatttagcatgtagactgctgggg
caatcaatggatgagagtggattaccacagctgaccagttacgattgtgaagttaatgct
cctgtacaaggcagcagaaacctactgcagggtgaagaattactcagagctttggatcaa
gttaactga

DBGET integrated database retrieval system